KEGG   Xenopus laevis (African clawed frog): 108709651Help
Entry
108709651         CDS       T01010                                 

Gene name
wbscr17.S, galnt16, galnt20, galntl3
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17 S homeolog
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00512  Mucin type O-glycan biosynthesis
xla01100  Metabolic pathways
Module
xla_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108709651 (wbscr17.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xla01003]
    108709651 (wbscr17.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108709651 (wbscr17.S)
Glycosyltransferases [BR:xla01003]
 O-Glycan biosynthesis
  Mucin-type
   108709651 (wbscr17.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 108709651
NCBI-ProteinID: XP_018105170
Xenbase: XB-GENE-17343526
UniProt: A0A1L8H893
LinkDB All DBs
Position
2S
AA seq 598 aa AA seqDB search
MASLRRVKILLVLNLIAVAGFVLFLAKCRPITIKGGESFHEVHPRAEVTNFTSHASSAIQ
EAVLKRLALLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPDEVEKAKGPHEKYGY
NVYLSDKISLDRSIPDYRPTKCKTLTYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
VHLLKEIILVDDNSDEEELKGPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQEDRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRVFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKRKPYINNLDFYTKRNALRVAEVWMDDYKSHVYIAWNLP
MENPGIDIGDVSERIALRKRLTCKNFQWYLDNVYPEMRRYNSTVAYGELRNNKAKDVCLD
QGPPENHTAIMYPCHGWGPQLGRYTKEGYLQLGTLGSTNLLPDTRCVVDDKISKFPQLMD
CDKMKSTLQKRWSFIQNGAIMNRGTGRCLEVESRNNGGIDVILRSCTGQRWTIKHIIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctgagaagagtcaaaatcttgttggtgttaaacctgattgcggtagctgga
tttgtactatttttggccaagtgcagaccaattactataaaaggtggggaatctttccat
gaggtccatccgagggcagaagtgaccaactttacaagtcatgcgagcagcgcaattcag
gaagccgtgctgaaaagactcgctcttctagaggacatagtctacaggcagctcaatggt
ttatccaaatcacttggtcttattgaaggttatgggggcagaggaaaaggtggacttcca
gcaacactctctccagatgaagtagagaaagccaaaggaccacatgaaaagtatggctac
aatgtctacctcagtgacaagatttcactggataggtctataccagattatagacctact
aagtgcaagacactgacatattccaaggagctgcctcagatttcaataattttcatcttt
gtcaacgaagccctgtctgtgattctaagatcagtgcacagcgcagtgaaccacacacca
gtccatctgttgaaggagattatcctagtggatgacaacagcgatgaagaagagttaaag
gggcctctggaagaatacgttcacaagagatatcctggtttagttaaagttgtccgaaat
cagaaaagagaagggctgattcgtgctcggatagaaggctggaaagtcgctacaggacaa
gtcactggcttttttgatgctcatgtagaattcactgctggctgggcagaaccagttctt
tctcgaatacaagaagaccggaaacgggtcattttaccttcaatagataatatcaaacaa
gacacatttgaagtgcagagatatgaaaactctgcacatggatacagctgggagctctgg
tgtatgtatataagtccgcctaaagactggtgggatgcaggagatccatccttacctatc
aggacacctgcaatgatcggatgctcttttgtggtgaacagggtattctttggagaaatt
ggacttctagatccaggaatggatgtgtatgggggagagaatattgagcttggtatcaag
gtatggttatgtggtggaagcatggaagtgcttccatgttccagggttgctcacattgaa
cgtaagagaaaaccgtacattaacaacctggatttctacaccaagagaaatgcattgcgg
gtagctgaagtctggatggacgattacaaatcacatgtttatattgcatggaatttgcca
atggagaatccagggattgatattggagatgtatctgaaaggattgcactgagaaaacgc
ttaacgtgcaaaaatttccagtggtaccttgacaatgtttatccagaaatgagacgctac
aacagtactgttgcatatggggagctccggaacaataaagcaaaagatgtttgtctagac
caaggcccaccagaaaatcatacagctattatgtacccatgccatggatgggggcctcag
cttggaagatatacaaaagaaggatacttacaactgggaactcttgggagcacaaatctg
ttgcccgatacccgctgtgtagtagacgataagatcagcaaattcccccagcttatggac
tgtgataagatgaaaagtaccctccaaaaacgctggagttttatacagaatggagcaata
atgaacagaggaacgggacgatgtttagaagttgaaagtagaaacaatggtggcattgac
gtaatccttcggagctgtacaggtcaaagatggacaattaaacacattatcaaatag

DBGET integrated database retrieval system