KEGG   Xenopus laevis (African clawed frog): 108710010
Entry
108710010         CDS       T01010                                 

Gene name
sesn3.S
Definition
(RefSeq) sestrin 3 S homeolog
  KO
K10141  sestrin 1/3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108710010 (sesn3.S)
SSDB
Motif
Pfam: PA26 CMD FapA Cwf_Cwc_15 Tho2
Other DBs
NCBI-GeneID: 108710010
NCBI-ProteinID: XP_018105838
Xenbase: XB-GENE-17333165
UniProt: A0A1L8HAZ1
LinkDB
Position
2S
AA seq 484 aa
MNRRNSQTLCDSSDFLICGNCQRALRKDKKMLIPPPSRGPSAFIPQKEFGQANDVNKLTN
RLAEEYSTSGRLDNITQVMSFHPQYLESFLRTQFYLLRVDGPLPYHYRHYIAIMAAARHQ
CVYLINMHVEEFLSTGGSAEWLSGLEYIPQKLKNLNEINKLLAHRPWLIKKEHIQKLVRT
GENNWSLAELVHAVVLLAHYHALASFVFGSGINPERDPDTQNGIQTAVRNKFCVCDLAND
NNIENISQTSNDAEQNGDYESELEALMERMKKLQEEREDEEASQEEMATRFEKEKKESLL
VVSGAFDEEVISTSNVSRYIEDPGFGYKDFARRGEEHLPTFRAHDYSWEDHGFSLVNRLY
SDIGHLLDDKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQL
LERTLKVYIKTVTCYPERATKRMYDSYWRQFKHSEKVHVNILLMEARMQAELLYALRAIT
QHLT
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaaccggcgcaacagccagaccctgtgtgacagcagcgactttctcatctgtgggaac
tgccagagagcgctgaggaaggataagaaaatgctaattcctccgccttcaagaggacca
agtgcctttatcccacagaaagagtttggccaagcaaatgatgtgaataagctcaccaac
aggctggcggaagagtacagcacatccgggcgtttggataatatcacccaagttatgagt
ttccacccgcagtatctggaatcctttctgcgcacacagttttacttgctccgcgtggat
gggcccctaccgtaccattacagacactacatagctattatggcagcagccagacaccag
tgtgtgtatctgataaacatgcacgtggaagagtttttgagcactggaggttcagcggaa
tggcttagcggcttggaatacatacctcaaaagctgaagaatctcaatgaaatcaataaa
ctgctggcacacagaccctggcttataaaaaaggagcacatacagaaactggttagaaca
ggagagaataactggtctctggctgagctggtacacgctgtagtattgctggctcattac
cacgctcttgcaagttttgtattcggcagcggtataaacccagaaagagatccagatacc
caaaatggcatccagacagcagtgagaaacaagttttgtgtgtgcgatctcgccaacgac
aacaacatagaaaacatttctcagacaagtaatgatgctgagcaaaatggggattatgaa
agtgaattagaagctctgatggaaagaatgaagaaactccaagaggaaagagaggacgaa
gaagcttctcaagaagaaatggcgacacgttttgaaaaagaaaagaaagaaagtcttctt
gtagtttctggagcctttgatgaagaggtaatctccacgtcaaatgtctctcgttatatc
gaagaccccggctttggttataaggactttgccagacgaggagaggagcacttgcctaca
ttccgagctcatgactactcttgggaagatcatggcttttccctggtgaacaggctgtac
tctgacattggccatcttctagatgacaagtttcggatggtgtataacctcacgtacaat
accatggccacacacgaagacgtagataccaccatgttaagaagagccttatttaattac
gtgcactgtatgtttggcatcaggtatgatgactacgattatggggaagtgaatcagtta
ctggagcgcactctgaaggtttacattaaaacagtcacctgctaccccgagcgagccacc
aagcgcatgtatgatagctactggcgtcagttcaagcactcggagaaggtgcacgtgaat
atacttctgatggaagcccgtatgcaagccgagcttctctacgctctccgtgcaataacc
cagcacctgacctga

KEGG   Xenopus laevis (African clawed frog): 108717942
Entry
108717942         CDS       T01010                                 

Gene name
sesn1.S, PA26, XPA26
Definition
(RefSeq) sestrin 1 S homeolog
  KO
K10141  sestrin 1/3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108717942 (sesn1.S)
SSDB
Motif
Pfam: PA26 CODH_A_N
Other DBs
NCBI-GeneID: 108717942
NCBI-ProteinID: XP_018120888
Xenbase: XB-GENE-17336241
LinkDB
Position
5S
AA seq 500 aa
MPMSWESCRKRSCAGDAKTMRLSPRAALSPPEIICSRCSQTCNNKELGIRIPRPLRQGPS
RFVPEEEILQVASEDANMHSVFADAFVDLGRLDNITLVMVFHPQYLGSFLKTQHYLLQMD
GPLSHCYQHYIGIMAASRHQCSYLVNLHVNDFIHHGGDQKWLNGLENAPQKLRNLGELNK
MLAHRPWLITKEHIGQLLKAGEHSWSLAELIHAIVLLAQYHSLASFTFGCGINPEIHSDG
GHTFRPPSVGNYCICDITNGNHGSEGHHPVGSVMPTDSSCEVEALMVKMKQLQEGRDEEE
ASQEEMATRFEREKTESMVFATEDEDIPPDIDVSRHFEDTSYGYKDFSRRGMHVPTFRVQ
DYSWEDHGYSLVNRLYPDVGQLLDEKFHIAYNLTYNTMAMHKDVDTSTLRRAVWNYVHCM
FGIRYDDYDYGEINQLLDRSFKVYIKNVVCSPEKTSKRMYDGFWRQFKHSEKVHVNLLLM
EARMQAELLYALRAITRYMT
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgccaatgagctgggagagctgtaggaagcggagctgtgcaggggacgcgaagacgatg
aggttatctccccgggcagctctctcgcctccagagatcatttgcagccgctgcagccag
acctgtaacaacaaggaacttggaatccgaattccacgaccactaagacaaggacccagc
agatttgttcctgaagaagagattctgcaggtggcaagtgaggatgcaaacatgcattct
gtgtttgctgatgcttttgtagatttgggtcgcttagataacattaccctagtgatggta
tttcaccctcagtacttgggcagcttcctgaagactcagcattacttactgcaaatggat
gggcccctctcgcactgttaccagcactacattggcatcatggcagcatctaggcatcag
tgttcctatcttgttaatcttcatgtcaatgactttatacatcatggaggggaccaaaag
tggttaaatggcctggagaatgccccccaaaagttgcgtaaccttggggagctgaacaaa
atgctagcacaccggccgtggctcatcacaaaagagcatattgggcaattgctaaaagct
ggagaacacagctggtctttggcagaattaattcatgcaatcgttcttctggctcagtac
cactccttagcctctttcacatttggttgtggaattaacccagaaatacacagtgatggt
ggccacactttccgccctccctctgttggcaactactgtatatgtgatattaccaatggc
aaccatgggagtgaaggacatcatcctgttggaagtgtgatgccaacagactcctcttgt
gaagttgaagctttgatggtaaagatgaagcaacttcaagaaggcagagatgaagaagag
gcaagtcaggaagagatggcaactcgttttgagagagagaaaactgaaagcatggtgttt
gctacagaagatgaagacattcctccagatatagatgtttcccggcatttcgaagatact
agttatggttataaagatttctcccgacgagggatgcatgtgcctacttttcgagtgcag
gattacagctgggaagaccatggctattcactagttaatcgcctttatccagatgttggg
cagctattagatgaaaagttccacattgcttacaacttgacttataataccatggcgatg
cataaagatgtggatacttcaactttaagacgtgcagtatggaattatgtccactgtatg
tttggtataagatatgatgattatgattatggagaaatcaaccagttattagatcgcagt
ttcaaggtttacattaaaaatgtggtgtgcagtcccgagaagacttcaaagagaatgtat
gatggattttggagacaatttaagcactctgaaaaagtacatgtaaatttgcttcttatg
gaagcaagaatgcaggcagaactgctttatgctctgagagcaattactcgatatatgacc
tga

KEGG   Xenopus laevis (African clawed frog): 379559
Entry
379559            CDS       T01010                                 

Gene name
sesn1.L, PA26, sesn1, sesn1-A
Definition
(RefSeq) sestrin 1 L homeolog
  KO
K10141  sestrin 1/3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    379559 (sesn1.L)
SSDB
Motif
Pfam: PA26 CODH_A_N CMD
Other DBs
NCBI-GeneID: 379559
NCBI-ProteinID: NP_001079869
Xenbase: XB-GENE-866080
UniProt: P58003 A0A1L8G963
LinkDB
Position
5L
AA seq 481 aa
MRLSPRAALSSPEIICSRCSQSCNNKELGIRIPRPLGQGPSRFVPEEEILQLASEDANMH
SVFADAFTDLGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLSPCYQHYIGIMAASRH
QCSYLVNLHVNDFIHHGGDQKWLNGLENAPQKLRNLGELNKMLAHRPWLITKEHIKQLLK
AGEHSWSLAELIHAIVLLAHYHSLASFTFGCGINPEIHSNGGHTFRPPSVSNYCICDITN
GNHGTEGHLPVGIVMPTDSTCEVEALMVKMKQLQEGRDEEEASQEEMATRFEREKTESMV
FSTEDEDPPPDIDVSRHFEDTSYGYKDFSRRGMHVPTFRVQDYSWEDHGYSLVNRLYPDV
GQLLDEKFHIAYNLTYNTMAMHKDVDTSTLRRAVWNYVHCMFGIRYDDYDYGEINQLLDR
SFKVYIKNVVCSPEKTSKRMYDGFWRQFKHSEKVHVNLLLMEARMQGELLYALRAITRYM
T
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaggttatctccccgggcagctctctcatctccagagatcatttgcagccgctgcagc
cagtcctgtaacaacaaggaactaggaatccgaattccacggccactaggacaagggccc
agtagatttgttccagaagaagagattctgcagctggcaagtgaggatgcaaatatgcat
tctgtgtttgccgacgctttcacagatttgggccgtttagacaacattaccctagtgatg
gtatttcaccctcagtacttggagagctttctgaagactcagcattacttgctgcaaatg
gacggacccctctcaccctgttatcagcactacattggcatcatggcagcatctaggcat
cagtgttcctatcttgttaatcttcatgtcaatgactttattcatcatggaggggaccaa
aagtggttaaatggcttggagaatgccccccaaaagctgcgtaaccttggggagctgaac
aagatgctagcacataggccgtggctcatcacaaaagagcacattaagcaattgctaaaa
gctggggaacacagctggtctttggcagaattaattcatgcaatcgttcttctggctcac
tatcactctttagcctctttcacattcggttgtggaattaacccagaaatacacagtaat
ggtggccacaccttccgccctccatctgtcagcaactactgtatatgtgacattaccaat
ggcaatcatgggactgaaggtcatcttcctgttggaattgtgatgcctacagactccact
tgtgaggtcgaagctttgatggtgaagatgaagcaacttcaagaaggcagagatgaagaa
gaagcaagtcaagaagagatggcaactcgttttgagagagagaaaactgaaagcatggtg
ttttctacagaagatgaagaccctcccccggatatagatgtttcccggcattttgaagat
acaagctatggttacaaagacttctccagacgagggatgcatgtgcctacttttcgagtg
caggattacagctgggaagatcacggctattcactagttaatcgcctgtatccagatgtc
gggcagctattagatgagaagttccacattgcttacaacctgacttataataccatggca
atgcataaagatgtggatacttcaactttaagacgcgcagtatggaattatgttcactgc
atgtttggtataagatatgatgactatgattatggagaaatcaaccagctactggatcgc
agcttcaaggtttacattaaaaatgtggtgtgcagtcctgagaaaacgtcaaagagaatg
tatgatggtttttggagacaatttaagcactctgaaaaagtacatgtaaatttgcttctt
atggaagcgaggatgcagggagaactgctttatgctctgagagcaattactcgatatatg
acctga

KEGG   Xenopus laevis (African clawed frog): 414641
Entry
414641            CDS       T01010                                 

Gene name
sesn2.L, sesn2
Definition
(RefSeq) sestrin 2 L homeolog
  KO
K20394  sestrin 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    414641 (sesn2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    414641 (sesn2.L)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 414641
NCBI-ProteinID: NP_001084681
Xenbase: XB-GENE-866167
UniProt: Q6NU55
LinkDB
Position
2L
AA seq 413 aa
MRHRSSRGPSAYIPVSQLTGPYVGDNIAAVMGLHPDYLHVFWKTQHQLLRMDGALSLPER
HYVAIMASARHQCTYLVSLHSSCFLQVGGDLRWLEGFDAAPLKLRKLNDLNKILAHRPWL
ITKEHIEILLSSQGGHSWSLAELIHALLLLTHFHALSSFILGCGIYLPEDNNAVPRPPSP
DIPLSEGSSTLQEAERVLAEIKKLDEEGEETSQEEMETRFEREKRECAMVPTNGDNSKPV
CFPGILRFLEDPDFGYIDFTRRGEQAPPTFRAHDYTWEDHGYSLLQRLNPEVGQLLDDKF
QVAFNLTYHTCATHCGVDTFKLRRAIWNYIQCIYGIRYDDYDYGEVNQLLERSLKVYMKT
VTCHPERVTRQLYNDFWRQFKHSEKVHLNFLLLEARLQAALLYSLRAITRYMT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcggcatcgaagttccagaggacccagtgcttatatccctgtatcacagctaactggt
ccttatgttggtgacaatattgcagcagttatgggcctacatcctgattatctgcatgtt
ttttggaagacacagcatcagctgctgcgtatggacggagctctttcccttccggagaga
cactatgtggcaataatggcctctgctcgacatcagtgcacctatcttgtgtctcttcac
tcgtcctgctttctgcaggttggaggggatctccgttggctggaaggatttgatgctgcc
cctctgaaactgcgcaagcttaatgacctcaacaagatccttgctcacaggccgtggttg
ataaccaaagaacacattgagattcttctgagctcacaggggggccactcttggtctctt
gcagaactaatccatgctctgctgctgcttactcattttcatgcactttcttcttttatc
ttgggctgtggaatttaccttccagaggataataatgctgttccgcgccctccctctcca
gacatccctcttagcgagggcagcagcacattgcaagaggcagagcgagtccttgctgag
ataaagaaactggatgaggaaggagaagagaccagccaagaagaaatggaaaccaggttc
gagagggagaagagagaatgtgcaatggttccaaccaatggtgataacagtaagccagtg
tgctttcctggcatcctgcgctttttggaagacccagattttggctacatagattttact
cgtcggggtgaacaggctccgcctacatttcgtgcccatgattacacatgggaagatcat
ggttactcgcttctacagagattaaatccagaagttggacagctgctggatgacaagttc
caagtggccttcaatctaacttaccacacttgtgcgactcattgtggtgtggacacgttc
aaattaagacgtgcaatatggaactatatacagtgcatttatggaataaggtacgatgac
tatgattatggagaggtgaaccagttgcttgagaggagtctgaaagtttatatgaagact
gtcacatgtcacccagagagggtgacccgacagctgtataatgacttttggagacagttt
aaacactcagaaaaggttcacttgaactttcttctgctagaagctcgactgcaggctgct
ttgttgtacagtctcagagccatcacacgctacatgacgtga

KEGG   Xenopus laevis (African clawed frog): 443672
Entry
443672            CDS       T01010                                 

Gene name
sesn2.S
Definition
(RefSeq) sestrin 2 S homeolog
  KO
K20394  sestrin 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    443672 (sesn2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    443672 (sesn2.S)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 443672
NCBI-ProteinID: XP_018104945
Xenbase: XB-GENE-17336086
LinkDB
Position
2S
AA seq 413 aa
MWRRGTRGPSAYIPVSQITGPYVGDNIAAVMGLHPDYLHVFWKTQHQLLRMDGALSLPER
HYVAIMASARHQCTYLVSLHSSCFLQVGGDPRWLEGFDAAPLKLRKLNDLNKILAHRPWL
INKEHIEILLSSQGGHSWSLAELIHALLLLTHFHALSSFILGCGIYLSEDNNAVPRPPSP
DIPLNEGCSKLQEAERVLAEIKKLDEEGEETSQEEMETRFEREKRECAMVPTNGDNSKAV
CFPGILHFLEDPGFGYIDFTRRGEQAPPTFRAHDYTWEDHGYSLLQRLNPEVGQLLDDKF
QVAFNLTYHTCATHSGVDTSKLRRAIWNYIQCIYGIRYDDYDYGEVNQLLERSLKVYMKT
VTCHPERVTRLLYNDFWRQFKHSEKVHLNFLLLEARLQAALLYCLRAITRFMT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgtggcgtcgaggtaccagaggacccagtgcttatatccctgtatcacagataactggt
ccatatgttggtgacaatattgcagcagttatgggtctgcatcctgattatctgcatgtt
ttctggaagacacagcatcagctgctgcgtatggacggagctctttcccttccagagaga
cactatgtggcaataatggcctctgctcgacatcagtgcacctatcttgtgtctcttcac
tcgtcctgctttctgcaagttggaggggatccccgttggctagaaggatttgatgctgcc
cctctgaaactgcgcaaacttaatgacctgaataagatccttgctcacaggccatggttg
ataaacaaggaacatattgagattcttctgagctcacaggggggccactcttggtctctt
gcagagctaatccatgctttgctgctgcttactcattttcatgcactttcttcttttatc
ttgggctgtggaatttacctttcggaggataataatgctgttccacgccctccctctcca
gacatccctcttaatgagggctgcagcaaattgcaagaggcagagagagtccttgctgag
ataaagaaactggatgaggaaggagaagagaccagccaagaagaaatggaaaccaggttc
gagagggagaagagagaatgtgcaatggttccaaccaatggtgataacagtaaggcagtc
tgctttcctggcatcctgcactttctggaagatccaggttttggctacattgattttact
cgtcggggtgagcaggctccacctacattccgtgctcatgattacacatgggaagatcat
ggttactcgcttctacagagattaaatccagaagttggacagctgctggatgataaattc
caagtggccttcaatctaacttaccacacttgtgccactcatagtggtgtggacacatcc
aaattaagacgtgcaatatggaactatatacagtgcatttatggaataaggtacgatgac
tatgattatggagaggtgaaccaactgcttgagaggagtctgaaagtttatatgaagacg
gtcacatgtcacccagagcgggtgacccgactgctatataatgacttttggaggcagttt
aaacattcagaaaaggttcacttgaactttcttctgttagaagctcgactgcaggctgct
ttgttgtactgtctcagagccatcacacgctttatgacgtga

KEGG   Xenopus laevis (African clawed frog): 443904
Entry
443904            CDS       T01010                                 

Gene name
sesn3.L, sesn3
Definition
(RefSeq) sestrin 3 L homeolog
  KO
K10141  sestrin 1/3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    443904 (sesn3.L)
SSDB
Motif
Pfam: PA26 CMD Cwf_Cwc_15 FapA Tho2 DUF2408 DUF4446
Other DBs
NCBI-GeneID: 443904
NCBI-ProteinID: NP_001085478
Xenbase: XB-GENE-866375
UniProt: Q6GQC2
LinkDB
Position
2L
AA seq 480 aa
MNRRNSSDFLICGNCQRVLRKDKKMLIPQPSRGPSAFIPQKEVNFGQANDVNKLTNRLAE
EYSTSGRLDNITQVMSFHPQYLESFLRTQFYMLRVDGPLPYHYRHYIAIMAAARHQCVYL
INMHVEEFLSTGGSAEWLSGLEYIPQKLKNLNEINKLLAHRPWLITKEHIQKLVRTGENN
WSLAELVHAVVLLAHYHALASFVFGSGINPETDPDSLNGIQAAVRNKFCVCDLANDNNIE
NTSQTSNDAEQNGDYESELEALMERMKKLQEEREDEEASQEEMATRFEKEKKESLLVVSG
AFDEEVISMSNVSRYIEDPGFGYKDFARRGEEHLPTFRAHDYSWEDHGFSLVNRLYSDIG
HLLDDKFRMVYNLTYNTLSTHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQLLERT
LKVYIKTVTCYPERATKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITQHLT
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaaccggcgcaacagcagcgactttctcatctgtgggaactgccagagagtgctgaga
aaggataagaaaatgctaattcctcagccttcaagaggaccaagtgcctttatcccacag
aaagaagtaaattttggccaagcaaatgatgtgaataagctcaccaaccggctggcggaa
gagtacagcacatccggacgtctggataacatcactcaagttatgagtttccacccgcag
tatctggaatcctttctgcgcacacagttttacatgctccgtgtggatgggcccctaccc
taccattacagacactacatcgctattatggcagcagccaggcaccagtgtgtgtacctg
ataaacatgcacgtggaagagttcttgagcactggaggttcagcagaatggctcagcggc
ttggaatacatacctcaaaagctgaagaatctcaatgaaatcaataaactgctggcacac
agaccctggctgatcacaaaagagcacatacagaaactggtaagaacaggagagaataac
tggtctctggctgagctggtacacgccgtggtattgctggctcattaccacgcactggca
agttttgtattcggcagcggtataaacccagaaacggatccagattctctaaatggtatc
caggcagcagttagaaacaagttctgcgtgtgcgatcttgccaatgacaacaacatagaa
aacacatctcagacgagtaatgatgctgagcaaaatggggactatgaaagtgaattagaa
gcactgatggaaagaatgaagaaactccaggaggaaagagaggacgaagaagcttctcaa
gaagaaatggccacgcgttttgaaaaggaaaagaaagaaagtcttcttgttgtttctgga
gcctttgatgaagaggtcatctccatgtcaaacgtctctcgttatatcgaagaccccggc
tttggctataaggactttgccagacgaggagaggagcacttgcctacattccgagctcat
gactactcttgggaagatcatggcttttccctggtgaacaggctgtactctgacattggc
caccttctagatgacaagttccggatggtgtataacctcacatacaataccttgtcgaca
cacgaagatgtagataccaccatgctaagaagagccttatttaattacgtgcactgtatg
ttcggcatcaggtatgatgactacgattatggggaagttaatcagttactggagcgcact
ctgaaggtttacattaaaacagtcacctgctaccctgagcgagccaccaagcgcatgtat
gatagctactggcgtcagttcaagcactcggagaaggtgcacgtgaacctacttctgatg
gaagcccgaatgcaagcggagctcctgtatgctctccgtgccataacccagcacctgacc
tga

DBGET integrated database retrieval system