KEGG   Xenopus laevis (African clawed frog): 108710169
Entry
108710169         CDS       T01010                                 

Gene name
cdkn2d.L, ank2, ink4d, p19, p19-ink4d
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) L homeolog
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108710169 (cdkn2d.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108710169 (cdkn2d.L)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 108710169
NCBI-ProteinID: XP_018106813
Xenbase: XB-GENE-17339738
UniProt: A0A1L8H2U6
LinkDB
Position
3L
AA seq 161 aa
MLLRETSAGDRLTRAAARGDLLEVKRLLHEERIHPDCLNRFGKTALQVMMFGSTPVASEL
LKQGASPNIQDSFGTTPAHDAARCGFLDTLQVLLQHGAEVNTPDASGSLPIHLALKAGHV
PVITFLALISDLEHRDREGHTPSQLAAILDPRLASIFELST
NT seq 486 nt   +upstreamnt  +downstreamnt
atgttgctacgagagaccagcgccggagaccgcctgacccgagcggctgccaggggagac
ctattagaagtgaaaagacttctccatgaagagaggatccaccccgactgcctgaaccgc
tttggcaaaactgccctgcaggtcatgatgtttggcagcacccctgttgcatcagagctt
ttaaagcaaggtgcctctcctaatattcaagattcatttggcaccacccctgctcatgat
gcagcccgttgtgggttcctggacaccctacaagttttgcttcagcacggagcagaggtg
aacacacccgatgcgtctggctccctacctatacacctggcccttaaagccggccacgtt
cctgtcattaccttccttgcccttatctctgaccttgaacatcgcgatcgggaagggcac
acgccgtcgcagttggccgccatcttggatcctcgtctggcttccatatttgagctcagc
acatag

KEGG   Xenopus laevis (African clawed frog): 446719
Entry
446719            CDS       T01010                                 

Gene name
cdkn2d.S, cdkn2d, ink4d, p19, p19-ink4d
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) S homeolog
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    446719 (cdkn2d.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    446719 (cdkn2d.S)
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 446719
NCBI-ProteinID: NP_001086884
Xenbase: XB-GENE-865015
UniProt: Q6DDG4
LinkDB
Position
3S
AA seq 161 aa
MLLQETSAGDRLTRAAARGDLTEVKRLLHEERIHPDCLNCFGKTALQVMMFGSTPVASEL
LKQGATPNIQDAYGTTPAHDAARCGFLDTLQVLVQHGAEVNTPDASGSLPIHLALKAGHV
PVITYLALISDLQQHDREGHTPSQLAAILDPRLASIFELST
NT seq 486 nt   +upstreamnt  +downstreamnt
atgttgctacaagagaccagcgctggagaccgcctgacacgagcggctgccaggggagac
ctaacagaagtaaaaaggcttctccatgaagagaggatccaccctgactgcctgaactgc
tttgggaaaactgctctgcaggtcatgatgtttggcagcaccccagttgcatcggagctt
ttgaaacaaggcgccactcctaatattcaagatgcatatggcaccacccctgctcatgat
gctgctcgctgcggtttcctcgacaccctgcaggttttagtccaacatggagcagaggtg
aacacacctgatgcctctggctccctacctatacacctggcccttaaagcaggtcatgta
cctgtcattacctaccttgcccttatctctgaccttcagcaacatgatcgggaagggcat
acgccatcacagttggccgccatcttggatcctcgtctggcttccatatttgagctcagc
acatag

DBGET integrated database retrieval system