KEGG   Xenopus laevis (African clawed frog): 108710351Help
Entry
108710351         CDS       T01010                                 

Definition
(RefSeq) neuropathy target esterase-like
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108710351
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     108710351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 108710351
NCBI-ProteinID: XP_018106978
LinkDB All DBs
Position
3L
AA seq 1224 aa AA seqDB search
MGARLPCRSAEGQNDTFMLHILEAGLLAMGGVCFLCFLLWLIQRRSVDPHVTDIPKLQAQ
KIPFKLKKKPKVLSIKQRIRRRKWESLSVHHVEPPPAPLLKPTAEPMTPTLPPDVLYMLQ
SVRVLGHFERPLFFALCQHVVYEHYDPGQIVFCPGQLDSSIYIVLEGKLELSLTDPDGTP
WYMKSICSGDNVHSLLSILDVLTGHQRPYRTVTAKAVERSTLLRLPVEAFCTVFKSYPQS
LVRTVQIIALRLQRVTFLALHHYLGLTIELFLPDNSELTQSEKPKRPRLLRSVTHNEGDL
SSLEETTPPRRRAPPLKSSKSARSSVFWRSLDCELEQSQGFELSNDYETSNPTSTTNMKP
LANESEKARDERMKRLIESGKKQMAKVLNLSNAGLLDNRVTLHHAKAETVIARKGEQGVG
MHLVLSGCLHVYQGVIGREDSYVFETGPGEMIGQLTVLTGEPLIFTIRAVQDSAFLCLSR
AHFYQILRSHPHVLLTVAHSVARRVSPFVRQVDFAIDWMGVEAGKELYRMGDPSDCTYIA
LNGRLRSVITRPDGKKCVVGEHGRGELIGMVEALTHSPRATSVHAVRDSELAKVPDGALS
YIKKRYPQVVTRLIHILSQKVLGNLQEPQGDYTDPGNLASNLCTVCVLPCNSKVPLTAFT
LELKHALNAVGPTLVLTSDIIRARLGAHALESTHECQLSTWLAQQEDLHRIVLYQTESFI
TSWTVRCIRQADCILVVGLGGEDPALGELESFLENSPVRALKQLVLLHHTDGSAPSGTVE
WLNLRSWVSGHFHIRAPRRVFTKRPLHKVHELYTRVFQTEADRHGDFSRLARALTGNTIA
LVLGGGGARGFAHVGVIKSLEEAGIPVDMIGGTSMGAVVGGVYAEELKAVETKQRTSKWA
KMLSSLPKTAMDLTYPIASLLSGSTFNGTLRSLFGERQIQDLWLPYFCISTDISASAMRI
HREGCLWRYVRASASYTPYLPPLCDPRDSHLLLDGCYVNNLPADVAHSLGARTVLAVDVG
QQDKWDTWNYGDSLSGWWLLWKRINPWAEKVKVPDMAELQSRLSYVSGVNQLQLVKHSGY
CEYLSPPVQRFSTTDFHRFQEIYDVGYDYGKLIFTEWYRGDVVEKMLQDRSSLEFYQQQE
GVTSGVPGFTDLAEIVSCIEPVTSRHLFPEKQEGKDEVTLAEDKKVSVERNACETDEEKT
LRLQNTRGLAKHTEQNYLTKQRVH
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcacgactcccctgtagaagcgccgaggggcagaatgacacatttatgcttcat
attctggaggcggggctcctggctatgggaggagtctgctttctgtgttttctcctgtgg
ctgatacaaagaaggtcggtggatccccacgttaccgatatcccaaagcttcaagctcag
aagatcccattcaagctaaagaagaagccgaaagtgctcagtatcaagcaaaggattcgc
aggaggaaatgggaatcactttctgtgcatcatgtagaacctccacctgctccacttcta
aagccgacagctgagccaatgactcccacgttgccccctgatgtgctgtacatgctgcag
agtgtcagagtccttggtcactttgagaggcctctcttctttgccctctgccaacatgta
gtatatgaacactatgatcctggccaaattgtgttttgccctgggcagctggactctagt
atttacattgtcttggagggaaagctggagctgtcactgactgatcccgatggcacacca
tggtatatgaaatctatttgctcaggggataatgtgcacagtcttctcagtatcctggat
gtgctaacgggacaccagcggccataccggacagtgactgcaaaagctgttgagaggagc
accttgctccggcttcctgtagaagcgttctgcaccgtttttaagagctacccacagagc
ttagtacgcacagtgcagatcattgcactacgcctgcaaagagtcactttcctcgctctg
caccattacctgggactgaccatcgagctcttcctacctgataattctgaacttactcag
tctgaaaagccaaagcgtccacggctgctaagaagtgtgacgcataatgaaggagatttg
tctagtcttgaagaaacaacaccacctcgcagaagagcgccaccattgaagagcagtaag
tcggctcgttcctcagtcttctggcgctctctggattgtgagttggagcagtctcagggc
tttgaattatccaatgattatgagacttccaatccaacttcaactacgaatatgaagcct
ttggcgaatgaaagtgaaaaggccagagacgagaggatgaagagacttatagagtcaggc
aagaagcaaatggcaaaagttttgaatttatcgaatgctggcctgctggataacagggta
actcttcaccatgccaaagctgagacggttattgcccggaagggggagcagggggtagga
atgcacttagtgctttccggctgtctccatgtatatcagggtgtcattggtcgagaagac
tcctatgtttttgagactggcccaggtgagatgataggacaactgacggtccttacggga
gagcccctgatcttcacaatcagagccgtacaagacagcgccttcctatgcctgagccga
gctcacttctaccagattcttcgctcccacccacatgtcctcctcactgtggcccactct
gttgctcgtcgggtttctccctttgtgcggcaagtggatttcgctatagactggatggga
gttgaagccggaaaagaactctacagaatgggggatccatctgactgtacctacatcgcc
ctaaatgggcgtctccgttctgttataacgcgcccagatgggaagaagtgcgtggtcgga
gaacatggtcggggagaactgattggaatggtggaggcgttaacccacagtccaagagcc
acatcagtccatgcggtgcgagactcggagttggctaaagttcctgatggtgcactgtcc
tacatcaaaaaaagataccctcaggttgtgaccaggctgattcatattttaagtcagaaa
gtcttgggaaacctacaggaaccacagggagactacacagatccaggtaatcttgccagt
aacctgtgcaccgtttgtgtgttaccctgcaacagtaaggttcctctgactgcatttacc
ctggagctgaaacatgccctcaatgctgtaggcccgactctggttcttactagtgacatc
atcagagcgcgacttggggcccatgcattggaaagcacacatgaatgtcagctgtcaact
tggctggctcagcaggaagatcttcatcgtatcgtcttgtaccagacggaatcgtttatc
acgtcctggactgtgcgctgtatccgccaggcagactgcattctggtggttggattaggt
ggagaagatccagcacttggggagctagaaagtttccttgagaactctcctgttcgggct
ctaaaacagctggtccttttgcaccacactgatggctctgcaccctctggcacggtggaa
tggctaaacttgaggagctgggtttcgggacactttcatattcgggctcccagacgggtc
ttcacaaagaggcctctacacaaagtgcatgagctgtatactagagtctttcagacagaa
gctgaccgtcacggtgacttttctcgcctcgcccgtgcattgactggaaacaccattgct
ttggtgctgggaggaggtggagcaagaggctttgcccatgtgggagtgataaagtcattg
gaggaggccggaatccctgtggatatgattggagggacttccatgggggctgttgttgga
ggtgtctatgcagaagaactgaaagcagtcgagaccaaacagaggacaagtaaatgggca
aagatgctgtcatctttacccaaaacagccatggaccttacctatcctatcgcttcactt
ttatcaggctccaccttcaatggtacactgcgaagtctttttggcgaaagacaaattcag
gacttgtggctgccatatttctgcatcagtactgacatcagcgcttctgcaatgcgtatt
cacagagaggggtgtttatggcgttatgtccgtgccagtgcttcgtatacgccttacctt
cccccactttgtgatccgcgggactctcacctactattggatggctgctatgtcaataac
ctcccagccgacgtggctcattcgctgggagcccgtactgttcttgcagtggacgttggc
cagcaggacaaatgggacacatggaattatggggactctctgtctgggtggtggttacta
tggaaacgtatcaacccatgggcggaaaaagtcaaggtcccagacatggcagagctgcag
tctagattatcctatgtatcgggggtcaatcagctacaactcgtcaagcatagcggatac
tgcgaatacctgagcccccctgtccagcgcttcagcacaacggacttccaccgatttcaa
gaaatatatgatgtgggctacgactatgggaaacttatattcactgaatggtaccgtggg
gatgttgttgaaaagatgctgcaggaccgaagttctcttgaattttatcaacaacaggaa
ggggttaccagtggggtccctggatttactgaccttgcagaaattgtgtcctgcatcgag
cctgtgaccagcagacatctgttcccagagaagcaagagggtaaagatgaagtcacatta
gcagaagacaagaaagtttctgtagaaaggaatgcctgtgaaacagatgaagaaaagact
ttgcggttgcaaaataccaggggcttggccaaacatactgaacagaattatttgactaag
caaagggtgcattaa

DBGET integrated database retrieval system