KEGG   Xenopus laevis (African clawed frog): 108710741
Entry
108710741         CDS       T01010                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108710741
   04068 FoxO signaling pathway
    108710741
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108710741
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108710741
NCBI-ProteinID: XP_018107391
UniProt: A0A1L8GWC5
LinkDB
Position
3L
AA seq 149 aa
MSGVPLSPEAPGVERVSRAPSSPRSPARRCLFGPVDHELLARDLERSLRAMEEEKRERWN
FDFRNHRPLPGLLEWEETDKTPEFYHREPKSLRAEASPAESRAKKRNGEATDSSAPSMKK
SHRKEAEDTAGGSLTPPPEETPKKTKPST
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtcgggcgtgccgttatctccggaggccccgggtgtggaacgggtatcccgggccccc
agctcccctcgttcccccgccaggcgctgcctattcggcccggtggatcacgagctgttg
gcccgggacctggagcggagccttcgggcgatggaagaggagaagcgcgagaggtggaac
ttcgacttccgcaatcaccggccgctaccggggctcctcgagtgggaggaaacggacaag
acgcccgaattctaccaccgggagcccaaatcattgcgggccgaggcgagtccggcggaa
tcccgagcaaagaagcgcaacggagaggcaacggattcctctgccccctccatgaagaaa
tctcacaggaaagaagctgaagacacagcaggaggcagcttaactcctcccccagaggaa
acgcccaagaagaccaaacccagcacgtaa

DBGET integrated database retrieval system