KEGG   Xenopus laevis (African clawed frog): 108711020
Entry
108711020         CDS       T01010                                 

Gene name
igf1.L, IGF-I, Somatomedin, igf-1, xigf1
Definition
(RefSeq) insulin like growth factor 1 L homeolog
  KO
K05459  insulin-like growth factor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04150  mTOR signaling pathway
xla04510  Focal adhesion
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108711020 (igf1.L)
   04068 FoxO signaling pathway
    108711020 (igf1.L)
   04150 mTOR signaling pathway
    108711020 (igf1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108711020 (igf1.L)
   04115 p53 signaling pathway
    108711020 (igf1.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108711020 (igf1.L)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    108711020 (igf1.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    108711020 (igf1.L)
Cytokines and growth factors [BR:xla04052]
 Growth factors
  Growth factors (RTK binding)
   108711020 (igf1.L)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 108711020
NCBI-ProteinID: XP_018107813
Xenbase: XB-GENE-17330790
UniProt: A0A1L8GY28
LinkDB
Position
3L
AA seq 153 aa
MEKNNSLSAQLFKCYFCDFLKLKMHKMSYIHLLYLALCFLTLTHSAAAGPETLCGAELVD
TLQFVCGDRGFYFSKPTGYGSSNRRAHHRGIVDECCFQSCDFRRLEMYCAPAKPAKSARS
VRAQRHTDMPKAQKEVHPKNTSRGNTGSRGFRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaaaaaacaacagtctttcagcacaattatttaagtgctacttttgtgatttctta
aagctgaagatgcacaaaatgtcctatattcatctcctctacctggctttgtgttttctg
actttaacccattcagcagctgctggaccagagaccctctgtggtgctgaactggtagac
actcttcagtttgtctgtggagacagaggcttctattttagcaagccaacagggtacgga
tccagcaatcgaagagcgcatcacagaggaatagtagacgagtgctgtttccaaagctgt
gatttcagaaggctagagatgtactgcgctccagccaagccagccaaatcagcacgttct
gtacgtgctcaacgtcacactgatatgccaaaagcccagaaggaagtacacccgaagaat
acaagtcgaggaaacacaggaagtcgaggattccgaatgtaa

KEGG   Xenopus laevis (African clawed frog): 108712492
Entry
108712492         CDS       T01010                                 

Definition
(RefSeq) insulin-like growth factor I-A
  KO
K05459  insulin-like growth factor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04150  mTOR signaling pathway
xla04510  Focal adhesion
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108712492
   04068 FoxO signaling pathway
    108712492
   04150 mTOR signaling pathway
    108712492
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108712492
   04115 p53 signaling pathway
    108712492
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108712492
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    108712492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    108712492
Cytokines and growth factors [BR:xla04052]
 Growth factors
  Growth factors (RTK binding)
   108712492
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 108712492
NCBI-ProteinID: XP_018110181
UniProt: P16501 A0A1L8GUV7
LinkDB
Position
3S
AA seq 153 aa
METNNNLSTQLFKCYFCDILKLKMHKMSCIHLLYLVLCFLTLTHSAAAGPETLCGAELVD
TLQFVCGDRGFYFSKPTGYGSNNRRSHHRGIVDECCFQSCDFRRLEMYCAPAKQAKSARS
VRTQRHTDMPKAQKEVHPKNTSRGNTGSRGFRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaacaaacaacaatctttcaacacaattatttaagtgctacttttgtgatatctta
aagctgaagatgcacaaaatgtcctgcattcatctgctctacctggttttgtgtttcctg
actttaacccattcagcagctgctggaccagagaccctctgtggtgctgaactggtggac
actcttcagtttgtatgtggagacagaggtttctattttagcaagccaacagggtacgga
tccaacaatcgaagatcgcatcacagaggaatagtagatgagtgctgtttccaaagctgt
gatttcagaaggctggagatgtactgcgctcctgccaagcaagccaaatcagcacgttct
gtacgtactcaacgtcacactgacatgccaaaagcccagaaggaagtacacccgaagaat
acaagtcgaggaaacacaggaagtcgaggattccgaatgtga

KEGG   Xenopus laevis (African clawed frog): 378699
Entry
378699            CDS       T01010                                 

Gene name
igf1.S, IGF-I, igf-1, igf1, igf1-A, xigf1
Definition
(RefSeq) insulin like growth factor 1 S homeolog
  KO
K05459  insulin-like growth factor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04150  mTOR signaling pathway
xla04510  Focal adhesion
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    378699 (igf1.S)
   04068 FoxO signaling pathway
    378699 (igf1.S)
   04150 mTOR signaling pathway
    378699 (igf1.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    378699 (igf1.S)
   04115 p53 signaling pathway
    378699 (igf1.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    378699 (igf1.S)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    378699 (igf1.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    378699 (igf1.S)
Cytokines and growth factors [BR:xla04052]
 Growth factors
  Growth factors (RTK binding)
   378699 (igf1.S)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 378699
NCBI-ProteinID: NP_001156865
Xenbase: XB-GENE-6252361
UniProt: P16501
LinkDB
AA seq 153 aa
METNNNLSTQLFKCYFCDILKLKMHKMSCIHLLYLVLCFLTLTHSAAAGPETLCGAELVD
TLQFVCGDRGFYFSKPTGYGSNNRRSHHRGIVDECCFQSCDFRRLEMYCAPAKPAKSARS
VRAQRHTDMPKAQKEVHPKNTSRGNTGSRGFRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaacaaacaacaatctttcaacacaattatttaagtgctacttttgtgatatctta
aagctgaagatgcacaaaatgtcctgcattcatctgctctacctggttttgtgtttcctg
actttaacccattcagcagctgctggaccagagaccctctgtggtgctgaactggtagac
actcttcagtttgtctgtggagacagaggcttctattttagcaagccaacagggtacgga
tccaacaatcgaagatcgcatcacagaggaatagtagatgagtgctgtttccaaagctgt
gatttcagaaggctagagatgtactgcgctccagccaagccagccaaatcagcacgttct
gtacgtgctcaacgtcacactgatatgccaaaagcccagaaggaagtacacccgaagaat
acaagtcgaggaaacacaggaagtcgaggattccgaatgtaa

DBGET integrated database retrieval system