KEGG   Xenopus laevis (African clawed frog): 108711092
Entry
108711092         CDS       T01010                                 

Gene name
mdm2.L, Xdm2, xdm-2
Definition
(RefSeq) MDM2 proto-oncogene, E3 ubiquitin protein ligase L homeolog
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
xla04144  Endocytosis
xla04218  Cellular senescence
xla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108711092 (mdm2.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108711092 (mdm2.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108711092 (mdm2.L)
  09143 Cell growth and death
   04110 Cell cycle
    108711092 (mdm2.L)
   04115 p53 signaling pathway
    108711092 (mdm2.L)
   04218 Cellular senescence
    108711092 (mdm2.L)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108711092 (mdm2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108711092 (mdm2.L)
   04121 Ubiquitin system [BR:xla04121]
    108711092 (mdm2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108711092 (mdm2.L)
Membrane trafficking [BR:xla04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108711092 (mdm2.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    108711092 (mdm2.L)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS Pinin_SDK_N
Other DBs
NCBI-GeneID: 108711092
NCBI-ProteinID: XP_018107946
Xenbase: XB-GENE-17332976
UniProt: A0A1L8GYI7
LinkDB
Position
3L
AA seq 489 aa
MAEGEGCSQWRQPCNMNLTSTTNCLQNSHIMASDQEKLVKPTPLLLSLLKSAGAQKETFT
MKEVIYHLGQYIMAKQLYDEKQQHIVHCSNDPLGELFGVQEFSVKEPRRLYAMISRNLVS
ANVKESSEDIFGTDACSFPDKQSSQKEVLQELSVIAPTSDSKPCNLSQRKSNNETEEISS
VDHPAEQQRKRHKSDSISLTFDESLSWWVISGLRCDRNSSESTDTSSNPDPERHSVSDNS
DQDSDSDQFSVEFEVESVYSDDYSPSGDEHGVSEEEDINDEVYQVTIYEAEESETDSFDV
DTEISEADYWKCSECGEVNPPLPSHCPRCWTVRKDWLPEHRRKELQSLKRKRMETEEDEG
FDVPDCKKSKLTSSQDTNFDKKEAESIQSSESQETEDCSQPSTSGSIASCSQEVTKEDTS
EESMECSLPLTSIEPCVICQTRPKNGCIVHGRTGHLMACYTCAKKLKKRNKPCPVCREPI
QMIVLTYFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggagggcgagggctgctcgcaatggaggcagccgtgcaatatgaatctaacatcc
actacaaattgcttacaaaattcccacatcatggcttcagatcaagagaaactggtaaaa
cccacaccactcctgttatctttgttaaaatctgcaggtgcccaaaaggaaacctttaca
atgaaagaggttatttaccatcttggtcagtacataatggccaagcagttgtatgacgag
aagcagcaacatattgtccactgctccaatgatcctcttggagaactatttggtgtacag
gaattttctgtaaaagagccaaggagactgtatgcaatgatttctagaaatttggtttca
gcaaatgtaaaagagtcatctgaagacatttttggaactgatgcgtgcagtttccctgat
aaacagagtagtcagaaggaagtacttcaggagttatctgtaatagcacccacttctgac
tcaaagccatgcaacttatcccagaggaaaagtaacaatgaaacagaagaaatctcttca
gttgatcatcctgcagagcaacaaagaaagcgacataagtcagacagtatttctttaacc
tttgatgaaagcctttcgtggtgggtgatcagtggcttacggtgtgatagaaatagcagt
gaatcaacagatacttcctctaacccagatccagagagacactctgtcagtgacaattct
gatcaagattctgattcagatcagtttagtgttgaatttgaagtagaatctgtttattca
gacgattatagtcctagtggagatgaacatggtgtttcagaggaggaggatatcaacgat
gaggtatatcaggtgactatatacgaagctgaagagagcgagactgactcttttgatgtt
gatactgagatttcagaagctgattattggaaatgttcagagtgtggagaagtaaatccc
cctcttccaagtcattgtcctagatgctggactgtccgcaaagactggcttcctgaacat
agaagaaaagagcttcagtcattgaagagaaaaagaatggaaaccgaggaagatgaaggc
tttgatgtccctgattgtaagaaaagtaaactaacaagctctcaggacacaaattttgat
aaaaaagaagctgaaagcatacaaagttctgagtctcaggaaactgaggattgctctcag
ccttctacatctggcagtattgcttcatgcagtcaagaggtgaccaaggaagatacaagt
gaggaaagtatggagtgtagtcttccacttaccagcatcgagccatgtgtcatatgtcag
actcgccccaagaatggctgcattgttcatggcagaacaggtcatctgatggcatgctat
acctgtgcaaaaaagctcaagaagaggaacaaaccttgccctgtgtgtagagagccaatc
cagatgattgtgctaacttactttagctaa

KEGG   Xenopus laevis (African clawed frog): 108713153
Entry
108713153         CDS       T01010                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
xla04144  Endocytosis
xla04218  Cellular senescence
xla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108713153
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108713153
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108713153
  09143 Cell growth and death
   04110 Cell cycle
    108713153
   04115 p53 signaling pathway
    108713153
   04218 Cellular senescence
    108713153
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108713153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108713153
   04121 Ubiquitin system [BR:xla04121]
    108713153
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108713153
Membrane trafficking [BR:xla04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108713153
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    108713153
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 DZR zf-FPG_IleRS
Other DBs
NCBI-GeneID: 108713153
NCBI-ProteinID: XP_018111455
UniProt: A0A1L8GUE8
LinkDB
Structure
PDB: 

Position
3S
AA seq 488 aa
MSEGEGCSQWRQPCNMNLTSTTNCLENNHISTSDQEKLVQPTPLLLSLLKSAGAQKETFT
MKEVIYHLGQYIMAKQLYDEKQQHIVHCSNDPLGELFGVQEFSVKEPRRLYAMISRNLVS
ANVKESSEDIFGNVCCFPDKQSSQKEKLQELPDKLIAPASDSKPCNLSQRKSSNETEEIS
SVDHPAEQQRKRHKSDSFSLTFDESLSWWVISGLRCDRNSSESTDSSSNSDPERHSTNDN
SEHDSDQFSVEFEVESVCSDDYSPSGDEHGVSEEEEINDEVYQVTIYETEESETDSFDVD
TEISEADYWKCPECGEVNPPLPSYCPRCWTVRKDWLPEQRRKEPPPSKRKLMEIEEDEGF
DVPDCKKSKLTSSQDTNVDKKEAENIQNSESQETEDCSQPSTSGSIASCSQEVTKEDSSE
ESMESSLPLTSIDPCVICQTRPKNGCIVHGRTGHLMACYTCAKKLKKRNKPCPVCREPIQ
MIVLTYFS
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtcggagggagagggctgctcccagtggaggcagccgtgcaatatgaacctcacttcc
actacaaattgcttagaaaacaaccacatcagcacttcagatcaagagaaactggttcaa
cccacaccactgttgttatccttgttaaaatctgcaggtgcccagaaggaaacctttaca
atgaaagaggttatttaccatcttggtcagtacataatggccaagcagttgtatgacgag
aagcagcaacatattgtccactgctccaatgatcctcttggagaactatttggtgtacag
gaattttctgtaaaagagccaaggagactgtatgcaatgatttctaggaatttggtttca
gcaaatgtaaaagaatcatctgaagacatttttggaaatgtgtgctgttttcctgacaaa
cagagcagtcagaaggaaaaacttcaggagctgcctgataaactaatagctccagcttct
gactcaaaaccatgcaacttatcccagaggaaaagtagcaatgaaacagaagaaatatct
tcagtcgatcatcctgcagagcaacaaagaaagcgacacaagtcagacagtttttcttta
acctttgatgaaagcctttcgtggtgggtaataagtggcttacggtgtgatagaaatagc
agcgaatcgacagactcttcctctaattcagatccagagagacactctaccaatgacaac
tccgaacatgattctgatcagtttagtgtggaatttgaagtagaatctgtgtgttcagat
gactatagtcctagtggagatgaacatggtgtttcggaggaggaggagatcaatgatgag
gtatatcaggtgactatatatgagactgaagagagcgagaccgattcttttgatgttgat
actgagatttcagaagctgattattggaaatgcccagagtgtggagaagtaaatccccct
cttccaagttattgccctagatgttggactgtccgcaaggactggcttcctgaacaaagg
cgaaaagagcctccgccctcaaagagaaaattaatggagatcgaggaagatgaaggcttt
gatgtccctgattgtaagaaaagtaaacttacaagctctcaggatacaaatgttgataaa
aaagaagccgaaaacatacaaaattctgagtctcaggaaactgaggattgctctcagcct
tctacatctggcagtattgcttcgtgcagtcaagaggtgaccaaggaagattcaagcgag
gaaagtatggagtctagtctcccgcttacaagcattgatccatgtgtcatatgtcagact
cgccccaagaatggctgtattgttcatggcagaacaggtcatctgatggcatgctatacc
tgtgcaaaaaagctcaagaagaggaacaaaccttgccctgtgtgtagagagccaatccag
atgattgtgctaacttactttagctag

DBGET integrated database retrieval system