KEGG   Xenopus laevis (African clawed frog): 108711685
Entry
108711685         CDS       T01010                                 

Gene name
lpar2.L, lpa2
Definition
(RefSeq) lysophosphatidic acid receptor 2 L homeolog
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
xla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108711685 (lpar2.L)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108711685 (lpar2.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    108711685 (lpar2.L)
G protein-coupled receptors [BR:xla04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    108711685 (lpar2.L)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 108711685
NCBI-ProteinID: XP_018109133
Xenbase: XB-GENE-17343487
UniProt: A0A1L8H2P7
LinkDB
Position
3L
AA seq 344 aa
MSQCFYNESIKFFYNNSGKELYDTWRTKDKLVVGLGLTVCVFVMLFNLLVIAAIIINRRF
HYPIYYLLGNLAAADLFAGVAYTYLMFHTGPNTSKLTIKTWLVRQSLLDTSLTASVANLL
AIAVERHQTIFTMQLHSKMSNQRVFILIACIWIIALLLGLIPSFGWSCICNISACSRMAP
LYSRSYLIFWAVSNLVAFLIMMGVYMHIFIYVKGKMTRMSQHTSSQPKYRETMINLMKTV
FIILSAFVICWTPGQVVLLLDGLNCKSCNVLAVEKYFLLLAEINSVINPIVYSYRDNEMR
LTFKQILCFCCNRGSKYSPGPLKSTNTERRALADNGHLMRECSL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagtcagtgcttttataatgagagcattaagttcttttacaacaatagcgggaaagaa
ctctatgacacatggaggaccaaggacaagctggtggtgggcttgggacttacagtgtgt
gtctttgtgatgttgttcaacctgcttgtgatagccgccattatcatcaacagaagattc
cactatccaatctattatctcctggggaacctggctgcagccgatctgtttgctggggtt
gcttacacctacctcatgttccacacggggccaaatacatctaaactgacaataaagacc
tggctcgttcgacaaagtctactggacacgagtttgaccgcatcagtggccaatttactg
gccatagctgtagagaggcatcagacaatattcaccatgcagctccatagcaagatgtcc
aaccaacgggtgttcatcctcattgcctgcatttggattatagcgttgttgctgggtctg
atcccatcttttggttggagttgtatatgcaacataagtgcttgttccagaatggctcct
ctttacagcaggagctacctgatcttctgggcagtatccaacttggtggcttttctgatc
atgatgggggtctacatgcatatctttatctacgtcaaggggaagatgaccaggatgtcc
cagcacacgtcgtctcaacccaagtatcgggagaccatgataaacttaatgaaaactgtc
ttcattatcttaagtgcctttgtgatctgctggacccctggccaagttgtcctcctcctg
gacggtttaaattgcaagagctgcaatgttctggccgttgagaagtatttcctgctcctg
gctgagatcaattccgtcatcaatcccatagtgtactcctaccgggacaacgagatgaga
ctcaccttcaagcagattctttgcttctgctgcaacaggggttccaaatactctccagga
cccctgaagtcaactaacaccgagaggagagccttggctgacaatggacatttaatgaga
gaatgcagtctttag

DBGET integrated database retrieval system