KEGG   Xenopus laevis (African clawed frog): 108711827
Entry
108711827         CDS       T01010                                 

Gene name
epo.L, epoetin
Definition
(RefSeq) erythropoietin L homeolog
  KO
K05437  erythropoietin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108711827 (epo.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    108711827 (epo.L)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  CSF and other factors
   108711827 (epo.L)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 108711827
NCBI-ProteinID: XP_018109396
Xenbase: XB-GENE-17344413
LinkDB
Position
3L
AA seq 146 aa
MTPALSQGCKVLCQDSCNIICQFPEDIMVPETKLNLGEWNKLHTSQQAAEVWNGLILFTK
AVPRITDFISDASLKFQVEKIHSDIRSVVHLFKSLNLQDEAQTSQTEGKTLPVRTFKKLF
SVYTNFLRGKLRLLVMTVCREASLST
NT seq 441 nt   +upstreamnt  +downstreamnt
atgactcctgctttgtcacaaggctgcaaagttctctgtcaggactcctgcaatattatc
tgtcaatttcctgaggatatcatggtccctgaaacaaaactgaatcttggagagtggaat
aaattacacacgtcccaacaggcggcagaggtttggaacggtctcattttatttaccaaa
gctgtcccaagaattactgatttcatctcagatgccagcctcaaattccaagttgaaaaa
atccacagcgacatccgcagtgttgtgcatttatttaagagcctcaacttgcaggatgaa
gctcagacatcacagacagaaggaaagacacttccagtacggacattcaaaaaattattt
tctgtgtacaccaattttttacgaggtaaattgagactactagtgatgacagtgtgccgg
gaggctagcctatcaacgtga

DBGET integrated database retrieval system