KEGG   Xenopus laevis (African clawed frog): 108712172Help
Entry
108712172         CDS       T01010                                 

Gene name
tmprss9.L
Definition
(RefSeq) transmembrane protease, serine 9 L homeolog
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    108712172 (tmprss9.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108712172 (tmprss9.L)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108712172 (tmprss9.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 108712172
NCBI-ProteinID: XP_018109439
Xenbase: XB-GENE-6487939
UniProt: A0A1L8HVY8
LinkDB All DBs
Position
1L
AA seq 1150 aa AA seqDB search
MAEKNVDIEPVLNVQKANFLGTPCCRWTVACLLFGGVIISITAALLIMYLTTHSLIVTHT
LEVQGLQYDASLQNRTSLYHRSLTNTLQRLLRSSFRNTVAEEIYVGCTILQYRQGNESII
AYLKLQFLASIHFPGNEEIEELLRQGLASFLRGNIIPLPTFGNISSAVLTDNHGLSFYSI
GLKSGSCPAHVFACKNTQCIVKQNPECDNSRDCKDGSDEKNCNCGNRPAMQKTNRIVGGS
DATKGEFPWQVSLRENNEHFCGATIIGDKWLVSAAHCFNDFQDPAVWVAYIATTSLSGTD
SSTVKATIKNIIKHPSYNPDTADYDVAVLELDSALKFNKYTQQVCLPDPTHVFPVGKKCI
ITGWGYLKEDNLVKPEVLQKATVAIMDQSLCNSLYSNVVTERMLCAGYMEGKIDSCQGDS
GGPLVCEEPSGKFFLAGIVSWGVGCAEARRPGVYVRVSKIRNWIMDIISSSVALDPQTSL
PSTTTTTTTTTTGGKKTTNAKATTARPFTKHSTTRAKPVISTLPSKPTQKPQECGSRPGL
TKPNKIVGGLDAVRGEIPWQASLKEGSRHFCGATIIGDRWLVSAAHCFNQTKVDQVTAHM
GSTALSGVDTIAVKINLKRVIQHPHFNSLTLDFDVAVLELASSLTFNKYVQPVCLPSALQ
KFPAGWKCMISGWGNIKEGNVSKPEVLQKASVGIIDQKICSVLYNFSITERMICAGFLDG
KVDSCQGDSGGPLACEESPGIFFLAGIVSWGIGCAQAKKPGVYSRVTKLKDWILDTVAPV
LRTTDSGMNLPRSSSLPITTIRPSTFQPATSIGHRTTTLSRPTLSHTKSTRSTPKSTTKY
TSKRTTTAKTSTTALRITEPARSTQRPVPCSASTYKCSNRVCISKSNPECDGIQDCNNGS
DEHNCDCGFAPVLPYNKIVGGSGSVRGEWPWQVSLWLRRKEHKCGAVLISDRWLLSVAHC
FDIYSDPKLWAAYLGTPFLNGVEGRVEKIFRIHKHPFYNVYTLDNDVALLELPSPLTYTN
LIRPICLPDTSHIFPEGTRCFITGWGSTKEGGSMSRQLQKASVSIVGDQTCKKFYPIQIS
PRMMCAGFMQGGVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPYFPGVYTRITSV
RNWIGQNLRL
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaatgtggatattgagccagtgctgaatgttcagaaggccaattttcta
ggcacaccttgctgcaggtggactgtagcctgtctactttttggaggtgttatcatcagc
atcacagcagcattattaataatgtatttaacaactcatagcctcattgtgacacatact
ctggaggtacaaggacttcagtatgatgccagtctacagaatagaacctcattgtaccac
aggtcattaaccaatacactgcagaggctgttaagaagcagtttcaggaacactgttgca
gaagaaatctatgttggatgtacaattttacaatacagacaaggaaatgaaagcattata
gcttacttaaagttacagttccttgcttccatccacttccctggcaacgaggagatagaa
gaacttcttagacagggcctggcttctttcttaagagggaacattattccactacccaca
tttggaaacatctcttcagctgtacttacagataaccacgggctgtccttctactccata
ggcctcaagtcaggaagttgcccagctcatgtttttgcttgcaagaacactcagtgcatt
gtaaagcaaaacccagagtgtgataatagtcgagactgtaaagacggatcagatgaaaag
aactgcaattgcggtaaccggcccgccatgcagaaaaccaacagaatagttggtggatca
gatgctactaaaggagaatttccttggcaggtcagcctaagggagaacaatgaacacttc
tgcggagcaaccattattggtgacaagtggctggtgtctgcagctcattgcttcaatgac
ttccaggacccagcagtgtgggtagcttacatagcaactacctctctgagtggcacagac
agcagcacagttaaggccacaattaagaacatcatcaagcacccttcttataacccagac
acagctgattatgatgtggctgtattagaactggattcagcgctcaagttcaataagtac
actcaacaagtctgcctcccagatccaactcatgtattcccagttggcaagaaatgtatt
atcactggatggggctaccttaaggaggacaacttggtaaagcctgaagttctacaaaaa
gcaactgttgccattatggaccaatccctgtgcaatagcctctacagcaatgtggtgaca
gaaagaatgctgtgtgctggttacatggagggaaagattgattcctgccagggtgattct
ggtggtccactggtgtgtgaggagccatcaggaaagttttttttggcaggaatagtgagc
tggggtgtaggctgtgcagaagccaggaggcctggtgtttacgtgagagtaagcaagatc
agaaactggattatggatatcatttcctcatctgttgctctagatccacaaacaagttta
ccaagcactacgactaccaccaccaccaccaccactggtggaaagaaaacaactaacgca
aaagccaccactgcccgaccattcaccaagcattcaactaccagagccaaaccggtgatc
agcactttaccatctaaacctacacaaaagcctcaagaatgtggcagccgtcctggcctt
acaaaacccaacaaaatagtggggggactagatgctgtcagaggagagattccatggcaa
gccagcctaaaagaaggttcgcggcatttttgtggggccacaataattggggatcggtgg
ctagtgtctgctgctcactgctttaaccaaactaaagtagaccaagtcacagctcacatg
ggatccaccgcactaagtggagttgacacgatagctgtgaagatcaatttgaagagggta
atccaacatcctcacttcaattcattgaccttggacttcgatgtggctgtgttggaattg
gctagctcattaaccttcaataagtatgttcagcctgtttgccttccctctgccctgcag
aagtttccagctggttggaagtgcatgatatctggatggggaaacataaaagaaggcaat
gtgtccaaacctgaggtcctacagaaggcctctgtagggataattgaccagaaaatatgc
agcgtcctttacaacttttccattacggagcggatgatttgtgcagggtttctagatgga
aaagtggattcttgtcagggtgactctggtggtcctttggcatgtgaggaaagtccaggc
atattctttctggcaggaattgtaagctggggtattggatgtgctcaggcaaagaaacct
ggagtctatagccgagtcactaaacttaaggactggattttggacaccgtagctcctgtc
ttgaggacaacagacagtggaatgaaccttcctagatcatcatccctacctattactaca
ataagaccatctacttttcagccagcaacctccattggtcacagaacaacaactttatca
aggcccactttgtctcacaccaaaagcacaaggagcacacccaagtccactacaaaatat
actagcaaaaggacaactactgccaagaccagcacaacagcattaagaattacagaacct
gccagatccacacaaagaccagttccgtgctctgcctccacctataaatgctccaacaga
gtctgcataagcaaatccaatcctgagtgtgatgggatccaagactgcaataatggatct
gatgagcataactgtgattgtggctttgcacctgtactaccgtataacaagatagtgggt
ggaagtggttctgtacggggagaatggccttggcaagtcagcctctggctaaggaggaag
gaacataagtgtggagcagttctgatttctgaccgttggctgctttctgttgctcactgc
tttgacatttacagtgaccctaagctatgggcagcatatctgggtactccatttctaaat
ggagtggagggaagagtagaaaagatcttccgcattcacaagcatccattctacaatgtc
tacactctggataatgatgttgcccttctggaattgccttcacctctcacctacacaaac
ctcattaggcctatatgccttccagacaccagccatatctttccagagggaactagatgt
ttcatcacaggctggggctctaccaaggaaggaggttcaatgtcaaggcagcttcaaaaa
gcctctgtcagcattgttggagaccagacctgcaaaaaattctaccctattcagattagt
cccagaatgatgtgtgctggttttatgcaaggtggtgtggacagttgttctggtgatgca
gggggacccttggcatgtagggagccatctggccggtggtttctagctggaataaccagc
tggggttatggctgtgcaaggccttacttcccaggagtttacactcggataacgtcggtc
cgcaactggattggacagaatctacggttatga

DBGET integrated database retrieval system