KEGG   Xenopus laevis (African clawed frog): 108712595Help
Entry
108712595         CDS       T01010                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1-like
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xla00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108712595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108712595
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   108712595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 SAGA-Tad1 AgrB
Motif
Other DBs
NCBI-GeneID: 108712595
NCBI-ProteinID: XP_018110361
LinkDB All DBs
Position
3S
AA seq 651 aa AA seqDB search
MSCGPGECRGLPLYTFYSAPPASDPMHYSSVALRANPPLNNGSGAPCPAQDPTLQVSSPC
RGSRDLHGDSSPKCFYRHYLTRTSMQGDVYNFLERPSGWRCFIYHFSVFLLVLICLIFSV
LSTIEHYSEFATGTLFWMEIVLVVFFGAEYIVRLWSAGCRSKYVGFKGRIRFARKPISII
DLIVVIASIIVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQE
LITTLYIGFLGLIFSSYFVYLAEKDAVDEMGRTGFSSYADALWWGVVTVTTIGYGDKVPQ
TWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRC
YAAEKSCSSTATWKIYLTPPEQSNKTPTAPASPSSRKQNRRCKKKSKSIREACVNPMSPV
LAPLCLSPTLRTPRSPPQENALSVPHITYHHTEGDKPEDGLQDPAGRGRPGQSLPDISRT
NSYTDDMDGMSEESALPAVTDLSHTMSRLTEAHMMVVKVTRRMQYFVARRKFQQARKPYD
VRDVIEQYSQGHLNMMVRIKELQRRLDHSLGKPGLFLPEKGVDKGYYTVGSRIMRLEEKV
NRMDHKLDEILHIFRTQLVPEEDQAQSSQPSSPASHQLRPSPSSPTHSRKF
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtggcccgggggagtgcaggggtctccccctctataccttctactcagccccc
ccggcttcagaccccatgcattattcctctgtggccctcagggctaacccacccttgaac
aatggatctggggccccttgtccagcgcaggaccccacgctgcaggtgagcagcccttgc
aggggttcgagggacctgcatggagactcctcgcccaagtgcttctatcgccactatctg
acccgcaccagcatgcagggcgacgtctacaactttttggaaagacccagtggctggagg
tgcttcatctatcacttcagtgtgttccttcttgttctcatctgcctcatattcagtgtt
ctgtccacaattgaacattactcagaatttgcgactggaaccctcttttggatggagatt
gtcctggtcgtattttttggtgctgaatacatcgttcgcctctggtcggctggttgtcgt
agcaaatatgtcggattcaagggccggatccgctttgcccggaaacccatttctatcatt
gatctcattgtggtcatcgcgtccattattgttcttagtgtgggatccaacggacaagtc
tttgctacatctgcaattaggggtatccggttcctccagattctgcgcatgttacatgta
gatcgacaaggaggaacctggaggctgctgggatctgtggtgttcatccatcgacaggaa
ctcattacgactctgtatatcggcttcctgggactcatcttctcatcttactttgtgtac
ctggcggagaaggacgctgtagacgagatgggaagaacaggcttttccagttacgctgat
gccctctggtggggagtggtcacagtgacaactattggatacggggataaagttccgcag
acttggattggaaagaccattgcgtcctgtttctctgtttttgccatctctttctttgct
ctaccagctgggattctgggatctggttttgctctcaaagtgcagcagaagcagcggcag
aagcactttaacaggcagatccctgcagcagcttcactcatacagactctctggagatgt
tacgctgctgaaaaatcctgtagctccacagccacctggaaaatctacctgacccctccg
gagcagagcaataagacgcccacagccccagccagcccaagctcacggaaacagaacaga
agatgtaagaagaagagcaaatctatacgtgaggcatgtgtcaatcctatgagccccgtc
ctggccccactgtgcctctcccctaccctccggaccccacgcagccctccccaggagaat
gctctctctgtcccccacatcacctaccatcataccgagggggacaaaccagaggacggc
ttgcaggatccagcaggaagaggacgaccggggcagtccctcccggacatctcacggaca
aacagctatacagatgatatggacggaatgagcgaggaaagtgctctgccagctgttaca
gatctttcacacaccatgagcaggctgacagaagctcacatgatggtggtgaaggtcaca
cgcaggatgcagtattttgtagcccgccgaaaatttcagcaagctcggaaaccgtacgac
gtgagggacgtgattgagcagtattcccagggacacttgaatatgatggtacggatcaaa
gagctgcagagaaggttggatcattcattgggcaaaccaggactctttctgccagagaaa
ggagtggataagggatactacacggttggttctcggatcatgcgcctggaggaaaaggtg
aatcggatggatcataaactggacgaaatcctacacatcttccgaactcaactggtgcca
gaagaggatcaggcgcagtcctcccaaccgtcctcacctgcctcccatcaactgcgccct
tcccccagctcccccacccacagccgcaagttctga

DBGET integrated database retrieval system