KEGG   Xenopus laevis (African clawed frog): 108712769
Entry
108712769         CDS       T01010                                 

Gene name
tgfa.S
Definition
(RefSeq) transforming growth factor alpha S homeolog
  KO
K08774  transforming growth factor, alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108712769 (tgfa.S)
   04012 ErbB signaling pathway
    108712769 (tgfa.S)
SSDB
Motif
Pfam: EGF hEGF
Other DBs
NCBI-GeneID: 108712769
NCBI-ProteinID: XP_018110667
Xenbase: XB-GENE-17345507
LinkDB
Position
3S
AA seq 161 aa
MKMNVPSAGESRILLLGFLLAACQALENTTSQLSDPPVAAAVRSHFNDCPDSHMDFCFHG
TCRFIVQEDLPACVCQPGFVGTRCEHADLLAVVAANNKKQTITALVVVSIVATAVLIGTC
MLIHCCRRKQCQWCRAVFCQHEKPGSFLKDGVSCCKSETVV
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaagatgaatgtgccctccgcaggggaaagcaggattctcttactgggatttctgtta
gctgcttgccaagctctggagaacacaaccagccagctcagtgatcctccagtagcagct
gccgtgagatctcactttaatgattgccctgactctcacatggatttctgcttccatgga
acatgcaggttcatagtgcaagaagatctaccagcctgtgtatgccagccagggtttgtt
ggtacccgctgtgaacatgccgacctcttagcggtggtagcggccaataataagaaacaa
acaatcaccgctctggtggtggtgtctattgttgcaacagccgtccttattggaacttgc
atgttaatacactgctgcagaagaaagcagtgccagtggtgccgggctgtgttctgtcag
catgagaagcctggcagtttcttgaaagatggggtttcctgctgcaaatccgagacagtg
gtgtga

DBGET integrated database retrieval system