KEGG   Xenopus laevis (African clawed frog): 108712801
Entry
108712801         CDS       T01010                                 

Gene name
smad3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04144  Endocytosis
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108712801 (smad3)
   04350 TGF-beta signaling pathway
    108712801 (smad3)
   04371 Apelin signaling pathway
    108712801 (smad3)
   04068 FoxO signaling pathway
    108712801 (smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108712801 (smad3)
  09143 Cell growth and death
   04110 Cell cycle
    108712801 (smad3)
   04218 Cellular senescence
    108712801 (smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108712801 (smad3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 108712801
NCBI-ProteinID: XP_018110733
UniProt: A0A1L8GSA7
LinkDB
Position
3S
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKSGQLDELEKSLTTQSI
STKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEVCEYAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRNTEIPAEFPSLDDYSHSIPENTNFPAGIEPQINYIPET
PPPGYLSEDGETSDQMNHSIDTGSPNLSPNSMSPAHSNMDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDNAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcctcgatacttcccttcactccccccatcgtcaagaggctgctgggatggaagaag
ggagagcagaacgggcaagaggagaagtggtgcgagaaggcagtgaagagtctggtgaag
aagctgaagaagagcggacagctggacgagctggagaagtcactgaccacccagagcatc
agcaccaagtgcatcaccatccccaggtctctggatggaaggcttcaggtgtcccatcgt
aagggtttgccccatgtcatatactgccgcctctggaggtggccagatctgcacagtcac
cacgagcttcgagccatggaggtgtgtgaatatgccttcaacatgaagaaggacgaagtg
tgtgtgaatccttatcactaccagagagtggagactccagttctacctcctgtgctggtt
ccacgaaacaccgaaatcccggcggaattcccatcacttgatgattacagccattccatt
ccagaaaatacaaatttcccagcaggcatcgagccacagataaactacattccagaaact
cctcctcctggttacttgagtgaagatggggaaacaagcgaccaaatgaatcacagtata
gatacagggtctccaaatttgtctccaaactctatgtctcctgctcatagcaacatggac
ctgcagcctgttacatactgcgaaccggccttttggtgctccatctcctactatgagctc
aaccaacgcgtaggggagacgttccacgcttcccagccctccatgacagtggatggattc
accgacccttccaactctgaacgtttctgcctggggctgctgtccaacgtaaatcgaaat
gcagctgtggagctgacacggagacacatcggaagaggcgtgcggctgtattacattgga
ggagaagtgtttgctgagtgcctcagtgacaatgccatatttgtacagtccccaaattgt
aaccagcgctacggttggcatcctgccacagtctgcaagattccaccaggctgtaacttg
aagatatttaataaccaggagtttgctgctcttttggctcagtctgtaaaccagggcttt
gaggcggtgtatcagcttactaggatgtgcaccatacgcatgagttttgtcaaaggctgg
ggagccgaatacaggagacagactgtgactagcaccccctgctggatcgagctgcacttg
aacgggcccttgcaatggctggataaggttctcactcagatggggtctccaagtatccgc
tgctccagtgtttcttaa

KEGG   Xenopus laevis (African clawed frog): 378633
Entry
378633            CDS       T01010                                 

Gene name
smad3.L, XSmad3, XenMLP, Xmad3, madh3-A, smad3
Definition
(RefSeq) SMAD family member 3 L homeolog
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04144  Endocytosis
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    378633 (smad3.L)
   04350 TGF-beta signaling pathway
    378633 (smad3.L)
   04371 Apelin signaling pathway
    378633 (smad3.L)
   04068 FoxO signaling pathway
    378633 (smad3.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    378633 (smad3.L)
  09143 Cell growth and death
   04110 Cell cycle
    378633 (smad3.L)
   04218 Cellular senescence
    378633 (smad3.L)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    378633 (smad3.L)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 378633
NCBI-ProteinID: NP_001079320
Xenbase: XB-GENE-864816
UniProt: Q90YE5
LinkDB
Position
3L
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKSGQLDELEKALTTQSI
STKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEVCEYAFSMKKDEV
CVNPYHYQRVETPVLPPVLVPRNTEIPAEFPSLDDYSHSIPENTNFPAGIEPQINYIPET
PPPGYLSEDGETSDQMNHSIDTGSPNLSPNSMSPAHSNMDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDNAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcctcgatacttcccttcactccccccattgtcaagaggctgctgggatggaagaag
ggagagcagaacggacaagaggagaaatggtgcgagaaggcagtgaaaagtctggtgaag
aagctgaagaagagcggccagctggacgagctggagaaggcactgaccacccagagcatc
agcaccaagtgcatcaccatccccaggtctctggatgggagactccaggtgtcccatcgt
aaggggttgcctcatgtcatatactgccgcctctggaggtggccagatctgcacagtcac
cacgagcttcgagccatggaggtgtgtgaatatgccttcagcatgaagaaggacgaagtg
tgtgtgaatccttatcactaccagagagtggagactccagttctacctcctgtgctggtt
ccacgaaacaccgaaattccggcagaattcccttcacttgatgattacagccattccatt
ccggaaaataccaatttcccagcaggcatcgagccacagataaactacattccagaaacg
cctcctcccggttacttgagcgaagatggggaaacaagcgaccaaatgaatcacagtata
gatacagggtctccaaatctgtcaccaaactctatgtctcctgctcatagcaacatggac
ctgcagcctgtcacatactgcgagccggccttttggtgttccatctcctactatgagctt
aaccaacgcgtaggggagacgttccacgcttcccagccctccatgacagtggatggattc
accgatccttccaactctgaacgtttctgcctggggctgttgtccaacgtaaatcggaat
gcagctgtggagctgacacggagacacatcgggagaggcgtgcggctgtattacattgga
ggggaagtgtttgccgagtgcctcagtgacaatgccatatttgtacagtccccaaattgt
aaccagcgctacggttggcatcctgccacagtctgcaagattccaccaggctgtaacctg
aagatatttaataaccaggagtttgctgctcttttggctcagtcagtaaaccagggcttt
gaggctgtgtatcagcttacgaggatgtgcaccatacgcatgagtttcgtcaaaggctgg
ggagccgaatacaggcgacagactgtgactagcaccccctgctggatcgagctgcacttg
aacgggcccttgcaatggttggataaggttctcactcagatggggtctccaagtatccgc
tgctccagtgtttcttaa

KEGG   Xenopus laevis (African clawed frog): 399442
Entry
399442            CDS       T01010                                 

Gene name
mad2, MADH2
Definition
(RefSeq) Mad2 protein
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04144  Endocytosis
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    399442 (mad2)
   04371 Apelin signaling pathway
    399442 (mad2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    399442 (mad2)
  09143 Cell growth and death
   04110 Cell cycle
    399442 (mad2)
   04218 Cellular senescence
    399442 (mad2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 399442
NCBI-ProteinID: NP_001084329
UniProt: Q32N71
LinkDB
Position
1L
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSASGTTGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTANTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPSTLSPVNHNLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgcctttcaccccgccagtagtgaagcgcctgctaggatggaagaag
tctgcaagtggcaccacaggagcaggtggcggtgagcagaacggacaggaagagaagtgg
tgcgaaaaagcggtaaagagcttggtgaaaaaactgaagaaaacgggacaattagacgag
cttgagaaggcgatcacgacgcagaactgcaacacgaaatgcgtaacgataccaagcact
tgctctgaaatttggggactgagtacagcaaataccatagatcagtgggataccacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgactccaggtgtctcaccgt
aaaggattgccgcatgttatctactgcagactgtggcgctggccagacctgcacagtcat
catgaactgaaagcaatcgaaaattgtgaatatgcttttaaccttaaaaaagatgaagtt
tgtgtcaatccttaccattatcagagggtggagacaccagttttaccacctgtattagtt
ccacggcacacggaaatcttgacagagctgccacctcttgatgactacacgcattccatt
ccagaaaacactaattttcctgcagggattgaacctcagagcaattatattccagaaaca
ccacctcctggatatattagtgaagatggagaaactagcgatcagcaacttaaccaaagc
atggacacagggtcaccagctgagctgtctccgagtacactttctccagtcaaccacaat
ctcgatttgcaacctgtcacctattcggaacctgctttttggtgctctatagcatactac
gaactgaatcagcgagtaggagaaactttccatgcatcgcaaccatcgcttaccgtggac
ggctttacggacccctcaaactctgaaaggttctgcttaggtttactctcaaatgtgaac
cgaaatgccacggtggaaatgaccaggcgtcacataggaaggggtgtccggctatattac
atcggtggagaggtgtttgcagagtgcctaagtgatagtgctatttttgttcagagtcca
aactgtaaccagcgatatggatggcatccagcaactgtatgtaagattcctccaggatgc
aatctgaagattttcaataatcaagagtttgcggctctcctcgctcagtctgtgaatcaa
ggctttgaagcagtttatcagttaactcgaatgtgcaccataaggatgagctttgtaaaa
ggctggggtgctgaatacaggcgacagaccgttacaagcactccatgctggattgagctt
cacctgaatggacctttgcagtggttggacaaagtgttgacacagatgggatccccttca
gtccgctgctcaagcatgtcctaa

KEGG   Xenopus laevis (African clawed frog): 432023
Entry
432023            CDS       T01010                                 

Gene name
smad2.S, XSmad2, smad-2, smad2
Definition
(RefSeq) SMAD family member 2 S homeolog
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04144  Endocytosis
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    432023 (smad2.S)
   04371 Apelin signaling pathway
    432023 (smad2.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    432023 (smad2.S)
  09143 Cell growth and death
   04110 Cell cycle
    432023 (smad2.S)
   04218 Cellular senescence
    432023 (smad2.S)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 432023
NCBI-ProteinID: NP_001084964
Xenbase: XB-GENE-864923
UniProt: Q6IRR4
LinkDB
Position
1S
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSASGTTGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYSRLWRWPDLHSHHELKAVENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPSTLSPVNHNLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcgattttgccattcaccccaccagttgtgaagcgcctgttaggatggaagaag
tcagcaagcggcaccactggagcaggtggaggtgagcagaacggtcaggaagagaagtgg
tgcgagaaagccgtaaagagtttggtgaaaaaactgaagaaaacgggacaattagacgag
cttgagaaagcaataacgacacagaactgcaacacaaaatgcgtgacaataccaagcact
tgctctgaaatttggggactgagtacaccaaataccatagatcagtgggataccacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgactccaggtgtctcaccgt
aaaggattgccccacgttatctacagccggctgtggcgctggccagacctgcacagtcat
cacgaactgaaagcagtcgaaaattgtgaatatgcttttaaccttaaaaaagatgaagta
tgtgtcaatccttaccattatcagagggtagagacaccagttttaccgccggtattagtt
ccacggcacacagaaatcttgacagagctgccacctcttgatgactacacgcattccatt
ccagaaaacactaattttcctgcaggaattgaacctcagagcaattatattccagaaaca
ccacctcctggatatattagtgaagatggagaaactagcgatcagcaacttaaccaaagc
atggacacagggtcgccagctgagctgtctccgagtacgctttctccagtcaaccacaat
ctcgatttgcaacctgtcacctattcggaacctgctttttggtgctctatagcatactat
gaactgaatcagcgagtgggagaaactttccatgcatcgcaaccgtctcttaccgtggac
ggctttacagacccctcaaactctgaaaggttctgtttaggtttactctcaaatgtgaac
cggaatgccacggtggaaatgaccaggcgtcatataggaagaggagtccggctatattac
atcggtggagaggtgtttgcagagtgcctaagtgatagtgctatttttgtccagagtcca
aactgtaaccagcggtatggttggcatccagcaactgtatgtaagatacctccaggatgc
aatctgaagatttttaataaccaagagtttgctgctctcctcgctcagtcggtgaatcaa
ggctttgaagcagtttatcagttaacgcgaatgtgcaccataaggatgagctttgtaaaa
ggctggggtgctgaatacaggcgacagaccgttacaagcactccatgctggattgagctt
cacctgaatggacctttgcagtggttggacaaagtgttgacacagatgggatccccttca
gtccgctgctcaagcatgtcctaa

DBGET integrated database retrieval system