KEGG   Xenopus laevis (African clawed frog): 108712802
Entry
108712802         CDS       T01010                                 

Gene name
map2k1.S, mek1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1 S homeolog
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04270  Vascular smooth muscle contraction
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04540  Gap junction
xla04620  Toll-like receptor signaling pathway
xla04810  Regulation of actin cytoskeleton
xla04910  Insulin signaling pathway
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108712802 (map2k1.S)
   04012 ErbB signaling pathway
    108712802 (map2k1.S)
   04370 VEGF signaling pathway
    108712802 (map2k1.S)
   04371 Apelin signaling pathway
    108712802 (map2k1.S)
   04068 FoxO signaling pathway
    108712802 (map2k1.S)
   04150 mTOR signaling pathway
    108712802 (map2k1.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108712802 (map2k1.S)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108712802 (map2k1.S)
   04210 Apoptosis
    108712802 (map2k1.S)
   04218 Cellular senescence
    108712802 (map2k1.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108712802 (map2k1.S)
   04540 Gap junction
    108712802 (map2k1.S)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108712802 (map2k1.S)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108712802 (map2k1.S)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108712802 (map2k1.S)
   04912 GnRH signaling pathway
    108712802 (map2k1.S)
   04914 Progesterone-mediated oocyte maturation
    108712802 (map2k1.S)
   04916 Melanogenesis
    108712802 (map2k1.S)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108712802 (map2k1.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108712802 (map2k1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108712802 (map2k1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     108712802 (map2k1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: STE group
  STE7 family
   108712802 (map2k1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like DUF3216
Other DBs
NCBI-GeneID: 108712802
NCBI-ProteinID: XP_018110734
Xenbase: XB-GENE-17341792
UniProt: A0A1L8GSC6
LinkDB
Position
3S
AA seq 395 aa
MPKKKPTPIQLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPIS
SYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQEFVNKCLVKNPAERADLKQLMVH
SFIKQSELDEVDFAGWLCSTMGLKQPSTPTHAAGV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcctaaaaagaagcctacgcccatacagctgaaccccaaccccgaagggactgctgtc
aacggaacccctacagccgagacaaaccttgaagctctgcagaaaaagctagaggagctt
gagctggatgagcagcagaggaagcgtctggaggcttttctcacccagaagcagaaagtt
ggagaactgaaggatgacgactttgagaaagtttcggagcttggagcaggcaatggagga
gtggtgtttaaggtgtcccacaagccgaccagcttgattatggctagaaagttaattcat
ctggagattaagcctgcaatccgaaaccagattatccgagagttgcaggttctgcatgag
tgtaactccccatacattgtgggcttctatggggccttctacagtgatggagagatcagc
atttgcatggaacacatggatggaggctcccttgatcaggttttgaagaaagctggcaaa
atcccagagaagatattgggaaaagtcagcattgccgtgataaaaggtttaacctacctg
agagagaagcataagataatgcacagagatgtgaaaccttctaacatcctggtcaactct
agaggagagataaaactgtgcgactttggggtcagcgggcagctcatagattccatggca
aattcctttgttgggacaagatcctatatgtcgccagagaggctacagggcactcattac
tctgtgcaatccgacatctggagcatggggctgtcactggtggaaatggccattggaagg
tatcccattccaccgcctgatgccaaagagctggaacttatctttggctgttctgtagaa
ggggacccggcatcttctgaactggcacctcgcccccggccacccggacgtccaataagt
tcatatggtcctgatagtcgaccacccatggccattttcgaacttctggattatatagtg
aacgagccacctccaaaattgcccagtggagtatttggagcggagttccaggagtttgtg
aacaaatgtcttgtgaagaatccggctgagagagcagaccttaaacagctaatggttcac
agctttattaagcagtcagagttggatgaggtggattttgctggatggctctgttccact
atgggccttaagcagcccagtaccccaacccatgccgcaggagtgtga

KEGG   Xenopus laevis (African clawed frog): 379991
Entry
379991            CDS       T01010                                 

Gene name
map2k1.L, map2k1, mek-2
Definition
(RefSeq) mitogen-activated protein kinase kinase 1 L homeolog
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04270  Vascular smooth muscle contraction
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04540  Gap junction
xla04620  Toll-like receptor signaling pathway
xla04810  Regulation of actin cytoskeleton
xla04910  Insulin signaling pathway
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    379991 (map2k1.L)
   04012 ErbB signaling pathway
    379991 (map2k1.L)
   04370 VEGF signaling pathway
    379991 (map2k1.L)
   04371 Apelin signaling pathway
    379991 (map2k1.L)
   04068 FoxO signaling pathway
    379991 (map2k1.L)
   04150 mTOR signaling pathway
    379991 (map2k1.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    379991 (map2k1.L)
  09143 Cell growth and death
   04114 Oocyte meiosis
    379991 (map2k1.L)
   04210 Apoptosis
    379991 (map2k1.L)
   04218 Cellular senescence
    379991 (map2k1.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    379991 (map2k1.L)
   04540 Gap junction
    379991 (map2k1.L)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    379991 (map2k1.L)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    379991 (map2k1.L)
  09152 Endocrine system
   04910 Insulin signaling pathway
    379991 (map2k1.L)
   04912 GnRH signaling pathway
    379991 (map2k1.L)
   04914 Progesterone-mediated oocyte maturation
    379991 (map2k1.L)
   04916 Melanogenesis
    379991 (map2k1.L)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    379991 (map2k1.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    379991 (map2k1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    379991 (map2k1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     379991 (map2k1.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: STE group
  STE7 family
   379991 (map2k1.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like DUF3216
Other DBs
NCBI-GeneID: 379991
NCBI-ProteinID: NP_001080299
Xenbase: XB-GENE-865216
UniProt: Q05116 A0A1L8H157
LinkDB
Position
3L
AA seq 395 aa
MPKKKPTPIQLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVERDPASSELAPRPRPPGRPIS
SYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVH
SFIKQSELEEVDFAGWLCSTMGLKQPSTPTHAAGV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcctaaaaagaagcctacgcccatacagctgaatcccaaccccgaagggactgctgtg
aacgggacccctacagccgagacaaaccttgaagctctgcagaaaaagttggaagagctt
gagctggatgagcagcagaggaagcgtctggaggcttttctcacccagaagcagaaagtt
ggggaactgaaggatgacgactttgaaaaagtttcagagcttggagcaggcaacggagga
gtggtgtttaaggtgtcccacaagccaaccagcttgattatggccaggaagttgattcat
ctggagattaagcctgcaatccgaaaccagattatccgagagttgcaggttctgcatgaa
tgtaactccccatacattgtggggttctatggggccttctacagtgatggagagatcagc
atttgcatggaacacatggatggaggctcccttgatcaggttctgaagaaagctggcaaa
atcccagaaaagattttgggaaaagtcagcattgcagtgataaaaggtctaacctacctg
agagaaaagcataagataatgcacagagatgtgaaaccttctaacatcctggtcaactct
agaggagagataaaactctgcgactttggggtcagcgggcaactcatagactccatggca
aattcctttgttgggacaagatcctatatgtcaccggagcgactacagggcactcattat
tctgtgcaatcagacatctggagcatggggctgtcgctggtggaaatggccattggaagg
tatcccattccaccccctgatgccaaagagctggaacttatctttgggtgttctgtagaa
agggatccagcatcttctgaactggcacctcgcccccggccacccggacgtccaataagc
tcatacggtcctgatagtcgaccacccatggctatttttgaacttctggattatatcgtg
aacgagccgcctccaaaattgcccagtggagtatttggagctgagttccaggactttgtg
aataaatgtcttgtgaagaatccggcagagagagcagaccttaaacagctaatggttcac
agcttcattaagcagtcagagttggaggaagtggattttgctggatggctctgttccact
atgggccttaagcagcccagtaccccaacccatgccgccggagtgtga

DBGET integrated database retrieval system