KEGG   Xenopus laevis (African clawed frog): 108712920Help
Entry
108712920         CDS       T01010                                 

Gene name
mapk6.S, erk3, p97mapk, prkm6
Definition
(RefSeq) mitogen-activated protein kinase 6 S homeolog
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108712920 (mapk6.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108712920 (mapk6.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108712920 (mapk6.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-GeneID: 108712920
NCBI-ProteinID: XP_018110926
Xenbase: XB-GENE-6485781
UniProt: A0A1L8GSY5
LinkDB All DBs
Position
3S
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPNGRQLTDDVSSLTELNCVYIIQEYMETDLAKLLE
QGQLREEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVVKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIKNDMSEPHKPLPQLLSGISSDALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDDSHSHVYNWERYHES
DFSDHDWPIHNNFEVDEVQRDPRAFSDGSEDEEVQVDPRKYLDGDWEKYLEDPAFDPHFS
TEPCWQYLDHHENKYCDLECSHTCNYKMRSSSYLDSLVWKESEVNHYYEPKLIIDLSNWK
EQNKEKADKKGKSKCEMNGLVKAQLALAEASQQLVEKEREKHREFDFDSFIAGTIELSLQ
HDSSCVDKLNDLNSSVTQLELKNLISKSVNMEKQEKAMANLAQLGARNPNSWDSQIVSGE
HGFLKDQFCCDVRKDDHVKKETSYTSYLDDFFSKKEETEVTETEILGDAKVGVKDFDDGL
LSFTGDIILNKQLDCIGIPQFYNPVGSPLKSIQPTLAPSAMKLSPQIPHKTYSSILKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagtttgaaagcctcatgaacattcatggatttgatttgggatccagatat
atggacttaaaacctcttggctatggtgggaatggcttagttttttctgctgttgataat
gactgtgataagcgggtggctgtgaagaaaatcgttctgaccgatcctcagagtgtcaaa
catgctctgcgagagatcaaaattatccggagacttgaccatgataacattgtaaaagta
tttgaaattctcggtcctaatggaagacagttaacagatgatgtgagctctttaacagag
ttgaactgtgtttacattatccaagaatacatggagactgaccttgcgaagctgctagag
cagggccagttaagagaagagcatgcaaggctcttcatgtaccagctgctacgggggctc
aagtatatccactccgctaatgtgctgcacagagatctgaaaccagcaaaccttttcata
aacacagaagatctagtggtgaaaattggagattttggtcttgcgcgtattatggatccc
cattattctcataagggacatctttctgaaggacttgttacaaaatggtacagatctccc
agactcctactttctcccaataattacactaaagcaattgacatgtgggctgctggatgc
atctttgcagaaatgttaactggaaaaacactttttgcaggtgcacatgagcttgaacaa
atgcagctgatcctggaatcaatacctgttgtgcatgaagaagaccgccaagagctcctc
agtgtaatcccagtgtatatcaaaaatgacatgtcagaaccgcataagcctttaccacag
ctgctttcaggcatcagctcagacgcgctggattttttggagcaaatattaacattcagt
cccatggacagactgacagcagaagaagctttgtcccatccatacatgagcatttactct
ttcccaatggatgagccaatttcaagccatccttttcacattgaggatgaggtggatgat
atattattgatggatgacagccacagccatgtctataactgggaaagataccacgaaagc
gatttttcagaccatgattggcctatacataataattttgaagttgatgaagttcagcgt
gaccctagggctttctctgatggtagtgaagatgaagaagtacaagtggaccctcgcaaa
tatcttgatggagactgggaaaagtatcttgaagatcctgcatttgatcctcacttttct
actgagccttgctggcaatatctagatcaccatgaaaataaatattgtgatctggaatgt
agccatacatgtaattacaaaatgagatcttcctcttatttagatagcttagtatggaag
gagagtgaagttaaccattattatgaaccaaagcttataattgatctttctaactggaag
gaacaaaataaggagaaggcagataagaaggggaaatccaaatgtgaaatgaatggttta
gtgaaagcccagttagcgctagcagaagcttcacaacaactggtagaaaaggaaagggaa
aagcacagagaatttgactttgattcgtttattgcaggtaccattgagcttagtttgcag
catgattcctcttgtgtagacaaactcaatgatttaaatagctcagtgacacaacttgaa
ctgaagaatttaatctcaaagtcagtaaacatggaaaaacaagagaaagcaatggccaac
ttagcacagttaggtgctagaaatccgaattcttgggatagtcagattgtaagtggggaa
cacggttttctgaaagaccagttttgttgtgatgtaaggaaagatgatcatgttaagaag
gaaaccagctatacaagttacttagatgatttttttagcaaaaaagaagagacagaggtg
accgaaacagagatattgggagatgcaaaggtcggtgttaaagattttgatgatggcctt
ttgagttttactggagacatcatccttaataaacaactggattgtattggtattcctcaa
ttttataatccggttggctccccgctaaaatctatacaacccacattggctccctctgcc
atgaaattgtcccctcaaattcctcacaaaacctacagcagcattctgaaacatctgaac
taa

DBGET integrated database retrieval system