KEGG   Xenopus laevis (African clawed frog): 108713786
Entry
108713786         CDS       T01010                                 

Gene name
ddb2.L
Definition
(RefSeq) damage-specific DNA binding protein 2 L homeolog
  KO
K10140  DNA damage-binding protein 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03420  Nucleotide excision repair
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108713786 (ddb2.L)
  09124 Replication and repair
   03420 Nucleotide excision repair
    108713786 (ddb2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108713786 (ddb2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    108713786 (ddb2.L)
   03400 DNA repair and recombination proteins [BR:xla03400]
    108713786 (ddb2.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     108713786 (ddb2.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      108713786 (ddb2.L)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 108713786
NCBI-ProteinID: XP_018112869
Xenbase: XB-GENE-17339696
UniProt: A0A1L8GIW4
LinkDB
Position
4L
AA seq 489 aa
MPPKRATRGRRNLEEEEEQEDVSLGKRKRENVKNAEAGQKKPSKRRSGGQRGSALDTPCS
RKESDCGTNRGDKWTSIVHYLYRSTLGGNVGAKYLQTPFLQSLASYILYRTNSPFVRRVT
TLEWHPMHPNTVAVGSKGGDIILWDYEELNNTLIPGIGAGGCITGMKFDPFNPNQLYTSS
VAGSTVLQDFSGRNIQTFTNTEDWAMWYCSVDVSAGRQCVVTGDNVGNVVLLETCGKEIW
KLRLHKKKVTHVEFNPRCDWLLATASVDQTVKLWDLRNMKDKSSCLYTLPHARGVNSAYF
SPWDGAKLLTTDQHSEIRVYSACDWAKPQHIIPHPHRQFQHLTAIKATWHPRYDLIVVGR
YPDPLFPGYSSDELRTVDVFDGQKGNIVCQLYDPYASGIVSLNKFNPMGDLLASGMGFNI
LIWSREILLMMKQEEMMKALREKGLSVGRKDLPNSRLPHSREKPGNKVGATENSKTRTVK
DSTKRGKHK
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgccccccaaaagagcaacacgtggaaggaggaatcttgaggaggaagaggagcaggaa
gacgtgtctctaggaaaaaggaaacgggagaacgtgaaaaatgctgaagccgggcagaag
aaaccatcaaagaggagaagcggggggcagcgggggtctgcactagacacaccctgcagc
agaaaagagtctgactgtggaacaaacagaggggacaagtggacaagtatagtgcattat
ctgtatcgcagcactctggggggcaatgtcggagcaaagtacctgcaaaccccctttctc
cagtccctggcttcctacatattatatcggaccaacagcccctttgttcgtagggttacc
actctggagtggcaccctatgcacccaaataccgttgcagtgggatcgaaaggaggagac
atcatcctgtgggactatgaagaactcaataacacccttattcctgggattggagcagga
gggtgcatcaccggaatgaagttcgacccgtttaaccctaatcagttgtacacctcgtca
gtggcgggtagcacggtgctgcaggacttctctgggcgcaatatacaaacgttcaccaac
actgaggactgggcaatgtggtactgcagcgtcgacgtctctgctggaaggcagtgtgtg
gtcactggggataacgtcggcaatgtggtcctcctagagacctgtgggaaggagatttgg
aagttacggctgcacaagaagaaagtcacgcacgttgaattcaacccacgctgtgattgg
ctgctggcgaccgcttctgtggatcagaccgtgaagctgtgggacctgagaaacatgaaa
gacaagtccagctgtctgtacacattgccgcacgcacggggtgttaactctgcttatttt
agcccctgggatggagcaaagctactcactaccgatcagcacagcgagatccgtgtctac
tcagcatgtgattgggccaaaccgcagcacataatacctcatcctcacaggcaattccag
cacttgactgcaataaaggctacgtggcatccccgctatgatttaattgttgttggccga
taccccgacccgctctttccaggatattcgtcagatgagctgcggacagtagacgtgttt
gatgggcagaaagggaacatcgtgtgccagctctatgatccttatgcatctggtattgtt
tctctcaacaaatttaatccaatgggagatcttctggcttctggcatgggttttaatatc
ttgatctggagccgggagattctgttgatgatgaagcaggaggagatgatgaaggctctg
agggaaaagggactttcagtggggagaaaggaccttccgaattccagattgccacattcc
agagagaagccagggaataaagtcggtgcgacggagaacagtaagacacggactgtaaag
gactctactaagcgcgggaagcacaagtga

KEGG   Xenopus laevis (African clawed frog): 108715228
Entry
108715228         CDS       T01010                                 

Gene name
ddb2.S
Definition
(RefSeq) damage-specific DNA binding protein 2 S homeolog
  KO
K10140  DNA damage-binding protein 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03420  Nucleotide excision repair
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108715228 (ddb2.S)
  09124 Replication and repair
   03420 Nucleotide excision repair
    108715228 (ddb2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108715228 (ddb2.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    108715228 (ddb2.S)
   03400 DNA repair and recombination proteins [BR:xla03400]
    108715228 (ddb2.S)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     108715228 (ddb2.S)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      108715228 (ddb2.S)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 108715228
NCBI-ProteinID: XP_018115661
Xenbase: XB-GENE-6487275
LinkDB
Position
4S
AA seq 432 aa
MPPKRPTHGKRNLEPPSGEEEEQEEVSPGKRKRETEKNATPCSSKDSNCGTNRGDKQTSI
VHYLYRSTLGGNVRAKYLRTPFLRSLASYILYRTNSPFDRRVTTLEWHPTHPNTVAVGSK
GGDIILWDYEQLNNTLIPGIGAGGCITGMKFDPFNPNQLYTSSVAGSTVLQDFSGRNIQT
FTNTEDWAMWYCSLDVSAGMQCVVTGDNVGNVVLLETCGKEIWKLRLHKKKVTHVEFNPR
CDWLLASASVDQTVKLWDLRNIKDKSSCLYTLPHARGVNSAYFSPWDGAKLLTTDQHSEI
RVYSACDWAKPQHIIPHPHRQFQHLTAIKASWHPRYDLIVVGRYPDPQFPGHTSEELRTV
DVFDGQKGNIVCQLYDPYASGIVSLNKFNPMGDLLASGMGFNILIWSREILLMLKQEELM
KALREKGLSVGR
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgccccccaaaagaccaacacatggaaagaggaatctggagcctccttcaggggaggaa
gaggagcaggaggaagtgtcccctggaaaaaggaaacgggagacagagaagaatgctaca
ccatgcagcagtaaagattccaactgcggaacaaacagaggggacaagcagacaagcata
gtgcactacctgtatcgcagcactctggggggcaatgtccgagcaaagtacctgcgaacc
ccttttctccggtctctggcttcatatatattgtatcggaccaacagtccctttgatcgt
agggttaccactctggagtggcaccctacacacccaaatacagtcgcagtgggatcgaaa
ggaggggacatcatcctgtgggactatgaacaactcaataacacccttattcctgggatt
ggagcaggcggttgcatcaccggaatgaagttcgatccgtttaatcctaatcagctgtac
acctcgtctgtggcgggtagcacggtgctacaggacttctctgggcgcaatatccaaacg
ttcaccaacactgaagactgggcaatgtggtactgcagcctcgacgtctctgctggaatg
cagtgtgtggtcaccggggataacgtaggcaacgtggtgctcctggagacctgtgggaag
gagatctggaagctgaggctgcacaagaagaaagtgacgcacgtagagtttaaccctcgc
tgcgattggctgctggcgtccgcttccgtggatcagaccgtgaagctgtgggacctgaga
aatatcaaggacaagtccagctgtctgtacacattgccgcacgcgcgcggtgtcaactct
gcttattttagcccctgggatggggcaaagcttctcactaccgatcagcacagtgagatc
cgtgtttattctgcatgtgattgggccaaaccacagcacataatacctcatcctcacagg
caattccagcacttgactgcaataaaggcttcttggcatccccgctatgatttgattgtt
gttggccgatacccggacccgcagtttccaggacatacatcagaagagctgcggacggta
gacgtgtttgatggacagaaagggaacattgtgtgccagctgtatgacccttatgcgtct
ggtattgtttcgctcaacaagtttaatccaatgggagatcttctggcttctggcatgggt
tttaacatcttgatctggagccgggagattctgttgatgttgaagcaggaggagctgatg
aaggctttgagagaaaagggactttcagtggggagatag

DBGET integrated database retrieval system