KEGG   Xenopus laevis (African clawed frog): 108713866
Entry
108713866         CDS       T01010                                 

Gene name
pidd1.L, lrdd
Definition
(RefSeq) p53-induced death domain protein 1 L homeolog
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108713866 (pidd1.L)
   04115 p53 signaling pathway
    108713866 (pidd1.L)
SSDB
Motif
Pfam: LRR_8 ZU5 LRR_4 Death Peptidase_S68 DUF4597
Other DBs
NCBI-GeneID: 108713866
NCBI-ProteinID: XP_018113026
Xenbase: XB-GENE-17341018
LinkDB
Position
4L
AA seq 920 aa
MERILDPLWEETNAEEPAPYLQHLADNRITLDVVPNGCRFFLQLTNDPRCHLELVEFLRL
NTNDVLIPQALNVLPRYTGLKSLVLKGGHDFDENGKTKSGLLSSLPSELCSLSNLQHLDL
SFNSLTELPLCVTSLSCLSSLLLCYNQIRTLPDTISNLRNLELLSIMSNQLAVLPGEIGQ
LGKLKTLDLSENKLACLPEDIAGLQECTELDLSGNCLTELPETMCQLVSLQQLHLHSNLL
VSVPVGLAVLPSLKCLDLKNNQLRYVPEEIMNCPCVRLQGNPIGVAEPTPSTDDHVPVLK
SKEIYLSSEDKSFLVTPDGGRVFLPLGPQFCFPLGAVSSNVTIYFRILPPDQEHVKLGHH
DVLLSYTLELQPHDIQFNQDVEICIPYFVKRSMRKRKVGKIIADIVAEQDSLDVPNILVT
PRTLRKREVVIRTYSGENWTDLATTICTKRNLAICRVPHFSWFFVVSRLVKDQCQVPKDG
EVLFSSVDQNIRIDFPPGATEETRTISMQVLPVSTADLQRITGDSQSTTSPLLCLSQSSS
DNFLCPVKIQLPLPTGVTGDTLDRSRLVLLHGDPQAQNWTDITSQVVFEITHIYARFQVD
HFSWYWLWYTTKTYIGEMAKNVYTRLRMYQVNFVALQRKRDPEQVLLQCVPKQKVDTTMK
KLKDRYKGPEPSDMVEIVEGEQFFAEFEQGLQLHSERPDCVNGKIVFVFYSRMKNIKEVY
MTSQADRKEKDVKGQVSFYRGSVPAGLPKEATKHRKGPNSHWMATLPLKLPKLKLQYGEN
EMGKNGQSLPPLNLGNAETGYLTETNLSSIARRIGHEWKTIGRNLGLSTGELDRISYNKR
DNLDEQIFDMLFSWARKIYDQQDCVQRLIEAMQESGRQDIAEEIEAVIKLGKQKYEQSIL
RLGLDQGNSSEDSAIAMSQS
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggagcgtattctggatcccctctgggaggaaaccaatgcagaggaaccagccccttac
ctacagcatctcgcagacaacaggatcactcttgatgttgtcccaaatgggtgcagattt
tttctgcagctgactaacgatccaagatgccaccttgaactggttgaatttctaagactc
aacaccaatgacgtgctcatcccccaagcactgaatgtccttcccagatatactggactg
aaatccctggttctgaaaggtggacatgattttgatgaaaatggtaaaacaaagagtggc
ctcctgagttccctaccttcagagctctgcagcctttccaacttgcagcaccttgatctc
agcttcaacagcctcacagagctgcccctctgtgtcacatctctctcctgtctcagttct
ctcctcctctgttataatcagattagaacactaccagataccattagcaatctgaggaat
ttggaactattgtccatcatgtccaaccagctagcagtccttccaggagaaataggacag
ttagggaagctcaagacactggacctatcagaaaacaagctggcatgccttccagaagat
attgctggactacaggaatgcactgagctagacctgtctgggaactgcctcacagaacta
cctgaaacaatgtgtcaactggtgtccctccaacaacttcacctccatagtaatttgctt
gtaagtgttcctgtcggtctagcagttctaccatcccttaaatgcctagacctaaaaaac
aaccaactgcgatatgttccagaagaaatcatgaattgcccctgtgtacggctccaggga
aatcctattggggttgctgagccaaccccttcaaccgatgatcacgttcctgttttaaag
tcaaaggaaatctacctcagctctgaagataaaagctttctagtgacaccggatggaggc
agagtgtttctgccattgggcccccagttttgttttcctcttggagcagtctcttctaat
gtcaccatctactttcgaattcttccacctgaccaggagcatgtgaaactgggacaccat
gatgtgcttctcagttacactttggagttacagccccatgatatccagtttaaccaggat
gtggagatctgcatcccctattttgtgaagcggtctatgcggaagagaaaggtagggaag
ataatagcagacattgtagcagagcaggactcactggacgtacctaacattttggtaacc
cctagaaccctgcggaaaagagaagtagtgatcaggacttacagtggagaaaactggact
gacttggccaccactatctgcacaaagcgaaacttggccatctgcagagtccctcacttc
tcctggttcttcgtggtgtcacgtttagtgaaagatcaatgtcaagtgccaaaagacgga
gaggtcttgttttctagtgtagaccagaacattcgtattgattttcctcctggtgccact
gaagagactagaactatcagcatgcaggttttgccagtgagcactgcagatttgcaaaga
atcactggagattcccagtctacaaccagccctctcctgtgtctgtcacagagctcatct
gataacttcctctgtcctgttaaaatccaactgccgcttccaactggggttacaggcgat
acacttgatcgctcccgactagtccttttacatggagacccccaggcccaaaactggacg
gatatcacaagtcaggtggtatttgaaatcactcatatttatgcacggttccaagtggat
catttctcctggtactggctgtggtacactaccaaaacttacattggtgagatggccaaa
aatgtatacactcgccttcgcatgtatcaggtgaattttgtggccctgcagagaaaaagg
gacccagaacaggtgctgcttcagtgtgttcctaaacaaaaggtggacactacaatgaag
aaactgaaggacagatacaaaggcccagagccctcagatatggtggagatagtggaggga
gaacaattctttgcagaatttgaacaaggtctccagctacattcagaacgtcctgattgt
gtgaatggcaaaattgtatttgttttttactctcgtatgaaaaacataaaggaagtatat
atgacatcccaagcagaccggaaagagaaggatgttaaagggcaggtgtcattttaccgt
gggtcagttccagctggtttgccgaaggaagcaacaaagcacaggaagggcccaaattcc
cactggatggccacactgcctctaaaacttccaaaactaaagctacagtatggggaaaat
gagatgggtaaaaatggccagtctttaccccctttgaatttaggcaatgctgagacaggc
tatcttactgaaaccaacctgtctagcattgcaagacgcatcggacatgagtggaagact
attggcaggaacctgggcctaagcactggggagctggatcgaattagctacaataaaaga
gataatctggacgaacagatttttgacatgctgttctcgtgggctagaaagatctatgac
cagcaggactgtgtgcagagactgatagaagccatgcaagagagtggcagacaggacatt
gcagaagagatcgaggctgtgataaagttgggaaagcagaagtatgaacaatccatcctc
aggcttggcctagaccaagggaacagcagtgaagactctgcaattgccatgagccagtca
tga

DBGET integrated database retrieval system