KEGG   Xenopus laevis (African clawed frog): 108714480
Entry
108714480         CDS       T01010                                 

Gene name
ep300.L, p300
Definition
(RefSeq) E1A binding protein p300 L homeolog
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04330  Notch signaling pathway
xla04350  TGF-beta signaling pathway
xla04520  Adherens junction
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108714480 (ep300.L)
   04330 Notch signaling pathway
    108714480 (ep300.L)
   04350 TGF-beta signaling pathway
    108714480 (ep300.L)
   04068 FoxO signaling pathway
    108714480 (ep300.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108714480 (ep300.L)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108714480 (ep300.L)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108714480 (ep300.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108714480 (ep300.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    108714480 (ep300.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    108714480 (ep300.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     108714480 (ep300.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    108714480 (ep300.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    108714480 (ep300.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    108714480 (ep300.L)
SSDB
Motif
Pfam: HAT_KAT11 KIX zf-TAZ Creb_binding DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 108714480
NCBI-ProteinID: XP_018114253
Xenbase: XB-GENE-6487298
LinkDB
Position
4L
AA seq 2499 aa
MADNLVDPGPPSAKKPKMSSPSLSSSDVPDFGSLFDLEQDLPDELINSSEFGLTNGGDLS
QLHNSMNMVPDAAAKHKQLSELLRGGTASSMSMGLGQQTQQNSPGISLLNSMVKSPMNQG
GLTSPNMGMAGSGNTGPTAQQINPTSAAGMMPGVNSPVNQHGMGINTGMMTAGNGQNMMH
GQMMNGSVGSGRGRPNMQYPNPNMGNTGNILAETLQGGPQIGGQPGMRGPQPTAMNKMGL
MNNPNPYGNAYGQNVVPQMGGNVMGSQMQNKAALQNSLSQFPVDKKPGVGMPNMNQQTST
QVQQAGMVTAAPPGMGAGAPQGIGSGAPTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQTLLGGPTVAMGATGSVGAVGQQPAPSINATNQIDPSSIERAYAALGLPYQGNQI
QSQPQAPVKGQQSGQSPQGMRSHNTMNSSTMGVNGGVGVQASSLLPDSLLHSGMNTQSAM
MNESGGIPNLGSMPIAAPPSSTGIRKPWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDR
RMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQHLMPTPPG
MPPTQMNQSQGMPQPQTGMSTNGPLPDPSSMMRANVPNQMMNRMQTQTGMNQFGQMGMPM
QSMGQRPPAPLQHPGQMGQTGPMNQMGFQARMQQSGTMQQTAQNQFLSQNQFQASPPVMN
TGGMNTGGLNASGMSMSQPGNQNPPSQAQMSNPNHPVSSPVMPPVAAGNQIHCSSHVQPM
HRNSPSPAPSRTPTPHHTPPGLTPQPAPTPAQPIIPTAAPTSQAPLQHRESPTPPQVTPS
LSIPTPVMPTTDQQIPTPPPQQPLQQFPSQQQPLPRPPSQPSLTTPVPTPTAQLPMQLHP
STPSTVNLECPSSNPPSTNSPEVRSQQPVQEPPPQEVKMEIKQEDDYLEPEPMEPPAEEK
PEVKVEGAVEDCKSEPVELEEKKEEVKTEIKEEDEKPETPASQTSPAPPGQSKKKIFKPE
ELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPKNTSVLQDYFEIVKTPMDLSTIKRK
LDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCG
RKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPKYGLLADRYHFCEKCFNEIQGECVSL
GDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLDCGRKMHQICVLHHETIWPTGFVCEAC
LKKAGRSRKENKFSAKRLPTTRLGSFLENRVNEFLRRQNNPEAGEVTIRVVHASDKTVEV
KPGMKSKFVDTGEMAESFPYRTKALFAFEEVDGAELCFFGMHVQEYGSDCPQPNQRRVYI
SYLDSVHFFRPKSLRTTVYHEILIGYLEYVKKLGYTAGHIWACPPSEGDDYIFHCHPADQ
KIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEE
SIKELEQEEEERKREENTSNESIEVGKGDSKNAKKKNNKKTSKKTSSLSRGSKKKPGMPN
VSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTIAR
DKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRYHCTVCEDYDLCITC
YNTNTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSL
PSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQ
QQLQHRLQQAQMLRRRMASMQRTGGVGPQQGLPSPNSAGPATPTGQQPPTPQTPQPPPQP
PVQQQPPPPNMPSYSMARAEPPRGISQGKAAGQMTPPTPPQTGPMQQQVQGPPPAAVEMA
MQIQRAAETQRQMAKAQIFPRPIMNPHQMQPMNPMPPIGMNPQQGPRGPVHLDSGIGPAG
MQQPQQQQHPPQPQTQPPWVHGGLPQPQSMQPGMQRSPIMSVQQQGQPMNMNPQPGIGQV
PGSSQTKQGTLPQVAVQNLLRALRSPSSPMQQQQVLNILQSNPQLLAAFIKQRAAKYANN
PNAQAAGNIPGMPAHGGLPQVVHSNPGMQGMNPMQAIGPRPGMPQQPQAPQQQPPQQPPI
PQQGMAGINPQGQPVNINHGGISPQFREILIRRQQIMQQQQQQQQQQQQQQQQQQQQQQQ
QQQGAGPGMVNHNQFQQHQVMSGYTQHQQQQQQQQQRFQHHIQMQQGNMGQMSQMSQGMP
GDASSGLQSFPQRLLHQQMGSPAQQNPMSPQQHMLQGPAQSPHLQGQQLPPSLTNQVRSP
QPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVGPGQGNPMDQGHYGSPDP
TSMLSQMAGLHGGGVSDLGMGADNSDLNPNLSQSALDIH
NT seq 7500 nt   +upstreamnt  +downstreamnt
atggctgacaatttggtggatcctgggcccccttctgctaagaagcccaagatgtcttct
ccttccctgtcttccagcgatgttccagattttgggtctctctttgacctggaacaggat
ttacctgatgagttgattaactcaagtgagtttggtctgactaatggtggagatctcagt
cagctacacaacagcatgaatatggtgcctgatgcagcagccaagcataagcagctttct
gagcttttgcgtggtggaaccgcctcaagcatgagcatgggccttgggcaacaaacacaa
caaaacagcccaggaataagcttactaaacagcatggtgaaaagtcctatgaaccaagga
ggacttacatcgccaaacatgggtatggcaggcagtggaaacactggaccaacagctcag
cagataaatcctacttcagcagcaggaatgatgcctggtgtaaatagccctgtaaaccaa
catggcatgggcatcaacacagggatgatgactgctggaaatggacaaaatatgatgcat
ggtcaaatgatgaatgggtctgttggatctggtagagggcgtcctaacatgcagtacccc
aatcctaacatgggcaatacaggcaacatacttgccgaaacacttcaaggtgggcctcaa
attggaggacagcccggaatgagaggtccgcagccaacagctatgaacaagatgggtcta
atgaacaatcctaatccttatggaaacgcgtatggacaaaatgttgttccccagatggga
ggcaatgttatgggatcacaaatgcagaacaaggcagcattacagaatagcctgtctcag
tttccagtggacaaaaaacctggagtcggcatgccaaatatgaatcagcagacatcgacc
caggttcagcaagctggaatggttactgcagctccaccaggtatgggagcaggtgccccc
cagggcattggctcaggggcgcctacagcagatcctgagaaaaggaaactgatccagcaa
caactggttcttctcctgcacgctcacaaatgtcagcggagggaacaggccaatggagaa
gtacggcagtgcaacttaccgcattgccggacaatgaagaatgtccttaatcacatgaca
cactgccaagctggcaaatcttgccaagttgcacattgtgcctcctcgcggcagataatt
tcgcactggaaaaattgcacacgacatgactgtcctgtctgtcttcctctgaagaatgca
ggagacaaacgtaatcaaactttgctgggtggtccaacagtggcaatgggagctactggt
tctgtgggggcagttggccagcaacctgctccttcaattaatgccactaaccaaattgac
ccaagctcaatagagagagcatatgcagcacttggtcttccttaccagggcaatcaaata
cagagccaaccacaagctccagttaaaggccaacagtcaggacagtcaccacagggaatg
cgctcccataacacaatgaattcaagcacaatgggagtcaatggaggagtaggtgtccaa
gcttccagtttgcttcctgactctctgttgcattcaggaatgaacactcagagtgcaatg
atgaatgagagtggtggcattcctaacctaggctcaatgcctatagcggcaccaccctct
agtactggaatccgcaaaccttggcatgaagatatcacacaggatctgaggaaccatcta
gtccacaaacttgttcaagccatattcccaacacctgatccagcagcattaaaggatcgt
cgaatggagaacttggtagcttatgctcgtaaagttgaaggggacatgtatgaatctgct
aacagcagggctgagtactaccacttgctagctgagaagatatacaagattcaaaaagag
ttggaggaaaagcgtcgaaccagattgcaaaagcaacatctaatgcccactccccctggc
atgcctcctacacaaatgaatcaaagccaaggaatgccccagccacaaactggaatgtca
actaacggccctttgccagatccaagcagcatgatgcgggctaatgtgccaaatcaaatg
atgaatcgtatgcagacacaaactggaatgaaccaatttgggcagatgggtatgccaatg
cagtccatgggccagagaccgccagctccacttcagcaccctgggcaaatgggacaaacg
ggccctatgaatcagatgggatttcaggcccgcatgcagcagtcaggtactatgcaacaa
actgcacagaaccagtttctgtcccaaaatcagtttcaggcatctcctcctgtgatgaat
actggaggaatgaatacaggaggcttgaatgcatctggcatgtccatgtcccagcctgga
aatcagaaccctccatctcaggcacagatgtctaatcccaatcatcctgtgagctctcct
gtgatgcctccagtggcagcagggaatcagatccactgttcgagtcacgtccaacccatg
caccgcaactcaccgtcccctgctccaagccgcacaccaacccctcaccacacgcctcca
ggcttaactcctcaacccgccccaacacccgcacagcctatcataccaacagcagcacca
acttcacaagcaccactacaacacagagaaagccctaccccaccacaagtgaccccttca
ttatccatccctacccccgttatgcctaccactgaccagcaaatccctacaccacctcct
cagcagcctttgcagcagtttccatcacaacaacagccattaccacggcctccttcacag
ccaagcctaaccacacctgtacccacgccaactgcacaactgccaatgcagcttcaccca
agcactccgtctacagtcaatctggaatgcccatcttccaatcctccctctactaatagc
cctgaagttcgctctcagcaacctgttcaagagccgccacctcaagaggttaaaatggag
atcaagcaagaagatgattatcttgagcctgagcctatggaacctccagcagaggagaag
cctgaggttaaagtggagggagcagttgaggattgcaaatctgagccagttgagctggaa
gagaagaaagaagaagttaaaacagaaatcaaggaggaagatgagaaaccagaaacccct
gcttcccagacatctcctgctccccctgggcagtccaagaagaagattttcaaacctgaa
gagcttcgccaggctctcatgcccactctggaagcattataccggcaagatccagagtcc
cttccttttcgtcaaccagtggatcctcagttattaggaatcccgaaaaatacctctgtc
ctgcaggattactttgagattgtcaagactcccatggacctttcaactattaaacgcaag
ttagacacaggacagtaccaagagccctggcagtatgtggaagatatctggctgatgttc
aacaatgcctggctatacaaccgtaaaacttctcgtgtctacaagtactgttccaagctg
gctgaggtgtttgagcaggagattgatccagtcatgcaaagcttgggatactgttgtgga
cggaagctcgagttttctcctcagaccctttgctgttatggaaagcaactctgtacaata
ccccgtgatgccacttactacagctatcaaaacagttcacccaaatatggccttctcgct
gataggtaccacttctgtgaaaagtgcttcaatgagatccagggggaatgcgtctctctc
ggtgatgaccccacccaacctcagaccaccatcagcaaagatcagttctccaaaaggaaa
aatgacacactggatccagaacaatatgtagaatgcttggattgtggcagaaaaatgcac
cagatctgcgtgttacatcatgaaaccatctggcccacaggctttgtatgtgaagcctgt
ctaaagaaagcaggccgatctcggaaagagaacaaattttctgccaaacgtcttccaact
acgaggcttggctcttttctggagaacagagtgaatgaatttctgagaagacagaataat
cctgaggctggagaggtaactattcgtgtggtccatgcatctgacaaaacggtggaagtg
aaacctggcatgaaatcaaagtttgtggatacaggcgagatggcagaatccttcccttac
cgaacaaaagccttatttgcgtttgaagaggttgatggagctgaattgtgtttttttgga
atgcatgtgcaagaatatggctctgactgtcctcagcccaatcaaaggcgtgtttatatt
tcctatctggacagtgtacatttctttcgtccaaagagccttagaacaactgtctatcat
gagattctcattggctatctggagtatgtcaagaaactagggtatacagcaggacacata
tgggcctgtcctccgagtgaaggagatgactatatatttcattgtcacccagcggaccag
aagatcccaaagcccaagcgcttgcaggagtggtacaagaagatgctggacaagtctgtg
tctgagagagtaattcatgattacaaggacatctttaagcaagcaacagaagacagactg
accagtgccaaggagctgccatactttgaaggggatttctggcctaatgtgctggaggag
agcattaaggaactggagcaggaggaggaagaaaggaagcgagaagaaaataccagcaat
gagagtattgaggttgggaaaggagacagtaaaaatgcaaagaagaaaaacaacaaaaag
accagcaaaaaaacaagcagcctgagcagagggagtaagaagaagcctggaatgcctaat
gtgtccaatgatctgtcacagaagctctatgctacaatggaaaagcataaagaggtattt
tttgtcatccgccttagtgctggaccagcggccaattctcttcccccaattgtagagcca
gaccccctaattccttgtgatctgatggatggacgggatgccttcctcacaattgctaga
gataaacacttggagttttcatctctacgcagagctaagtggtctacaatgtgcatgctg
gtggagctccatacacagagccaggaccgctttgtctatacctgcaatgaatgcaagcat
catgttgaaactcgttatcactgtactgtttgtgaggattatgatttgtgcatcacctgc
tacaacacaaatacccatgaacacaaaatggagaaacttgggcttggcttggacgatgag
agcaacaaccaacaagcagccgcaacccaaagccccggagattcccgccggctgagcatc
cagcgctgcatccagtctcttgtacatgcctgccaatgtcgcaatgcaaactgctctttg
ccctcatgtcagaagatgaagagagttgtacaacacaccaaaggctgcaagaggaaaacc
aacggagggtgtcctatctgcaaacagcttattgccctgtgctgctaccatgctaaacac
tgccaagaaaacaagtgccctgtgcccttctgtctcaatatcaagcaaaagctgcgacag
cagcagctgcagcataggttgcaacaggctcagatgctgcgacggcgcatggccagcatg
cagagaacgggtggggttggccctcagcagggtttgccttctccaaattcagctggccct
gccacaccaacaggccaacagccccccactccacagactcctcaaccaccgccccaacct
ccagttcagcagcagcctccgccacctaacatgccttcctacagcatggcgcgtgctgaa
ccccccaggggaatatcacagggcaaagcagctgggcaaatgactcctccaacgcctccc
cagactggaccaatgcagcagcaagttcagggtccaccaccagctgctgtggagatggca
atgcagatccaacgggctgcagagacacaaaggcaaatggcaaaagctcaaattttccct
cggcccataatgaacccacatcagatgcaacctatgaacccaatgccgcccataggaatg
aaccctcaacagggccctaggggtccagttcatttggattctggcatagggcctgctgga
atgcagcaacctcagcaacagcagcatccacctcagcctcaaacacaacctccatgggta
catggtggactaccccagcctcaatcaatgcaacctggcatgcagagatcacccataatg
tcagtacagcaacagggacaacctatgaacatgaatccccagcctggcattggacaggtg
cctggatcaagtcaaacaaaacaaggcacgctgccacaagttgctgtgcagaaccttctt
cgtgctttgcgttctcctagctcacccatgcagcagcagcaggttttaaatattttgcaa
tcaaacccacagcttctggctgcctttatcaagcaaagagcagccaagtatgccaataat
ccgaatgcacaggcagctggcaacattcccggtatgcctgcccatggtggccttccgcaa
gtagtgcattctaatcctggcatgcaaggcatgaaccctatgcaggcaattggccctcgc
cctggcatgcctcagcaacctcaagccccacaacagcagcctccacaacagccccctatt
ccccagcagggtatggcaggaataaatccacagggtcagccagtaaacatcaaccatggt
gggatttcccctcagtttcgtgagattctcatacgaaggcagcaaataatgcagcagcag
cagcagcaacaacaacaacaacagcaacaacagcagcagcaacaacaacaacagcagcag
cagcagcaaggagctggccctggaatggttaatcataaccagttccagcagcaccaagtc
atgtctggctacacacaacaccaacaacagcagcagcaacaacaacagcggttccagcac
cacatccagatgcagcaaggaaatatgggacaaatgagccagatgtcacagggaatgccg
ggtgatgcatcgagtggcctgcagagctttccacagcgcctcttacaccagcagatggga
tctccagcacaacaaaacccaatgagcccacaacagcacatgttgcaaggccctgcccag
tcccctcatttacagggacagcagctccccccatcacttaccaaccaagtgcgttctccc
caacctgtgccctctccacgtccccagtcacagcccccacactctagcccgtctccccgt
atgcagccccagccatccccacatcatgtttctcctcagaccagctctcctcacccagga
ttggtggggcctggccaagggaaccctatggatcaaggacactatggaagcccggatcct
acttctatgctttcacaaatggcaggtcttcatggagggggggtgtcagaccttggtatg
ggtgcagacaactcggaccttaatcccaacctctcacagagtgcactagatatccattag

KEGG   Xenopus laevis (African clawed frog): 108715729
Entry
108715729         CDS       T01010                                 

Gene name
ep300.S, p300
Definition
(RefSeq) E1A binding protein p300 S homeolog
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04330  Notch signaling pathway
xla04350  TGF-beta signaling pathway
xla04520  Adherens junction
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108715729 (ep300.S)
   04330 Notch signaling pathway
    108715729 (ep300.S)
   04350 TGF-beta signaling pathway
    108715729 (ep300.S)
   04068 FoxO signaling pathway
    108715729 (ep300.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108715729 (ep300.S)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108715729 (ep300.S)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108715729 (ep300.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108715729 (ep300.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    108715729 (ep300.S)
   03029 Mitochondrial biogenesis [BR:xla03029]
    108715729 (ep300.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     108715729 (ep300.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    108715729 (ep300.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    108715729 (ep300.S)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    108715729 (ep300.S)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 108715729
NCBI-ProteinID: XP_018116634
Xenbase: XB-GENE-17333763
LinkDB
Position
4S
AA seq 2508 aa
MADNLVDPGPPSAKKPKMSSPSLSSSDVPDFGSLFDLEHDLPDELINSSEFGLTNGGDLS
QLHTSMNMVPDAAAKHKQLSELLRGGTTSNMSMGLGQQTPQNSPGISLLNSMVKSPMNQG
GHASPNMGMGGSGNPGPTAQQMNPTSATGMMSGVNSPVNQHGMGINAGMIAGNGQNMIQG
QMMNGSVGSGRGRPSMQYPNPNMGNTGNLLAETLQGGPQIGAQSGMRGPQPTAMNKMGLM
NNPNPYGTTYGQNVVPQMGGTVMASQMQNKAALQNSLAQFPVDKKPGVGMPNMNQQTSTQ
VQQAGMVTAAPPGMGAGAPQGIGSGAPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEV
RQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAG
DKRNQSKSDLKEKERLKLTLLGGPPVTLGAAGAVGTVGQQPAPSINATNQIDPSSIERAY
AALGLPYQGNQLQTQPQAAVKGQQSGQSPQGMRSLNTMNSSTMGVNGGVGVQASSLLPDS
LLHSGMNSQSPMMNESGSVPNLGSMPTAAPPSSTGIRKPWHEDITQDLRNHLVHKLVQAI
FPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHFLAEKIYKIQKELEEKRRTR
LQKQHLMPTPPGMSPTQMNQSQGMAQPQTGISTNGPLPDPSSMMRANVPNQMMNRMQTQT
GMNQFGQMSMPMQSMGQRQQAPIQHPGQMGQTGPMNQMGFQARMQQPGTMQQTAQNQFLS
QNQFQASSPVMNTGGMNTGGMNASGMPMPQPGNQNSPSQAQMSNPSHPVSSPVMPPAAAG
NQIHCSSHVQPMHRNSPSPAPSRTPTPHHTPPGLTPQPALTPVQPIIPTAAPISHSPLQH
RESPTPPQVTPSLSIPTPVMPTTEQQIPTPSPQQPSQQFPSQQPIPRPPSQPSLTTSVPT
PTAPQLPMQLHPSTPPTANLDCPSSNPPSTNSSEVSSQQPVQEQQPPEVKMEIKQEDEDL
EPEPMEPPAEEKPEVKSEGAVEDCKSEPVELEEKKEEVKTEIKEEDEKPATPAAQTSPAP
PGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDAQLLGIPKNTSVLQDYFEIV
KTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEI
DPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPKYGLLADRYHFCEK
CFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNE
TIWPTGFVCEGCLKKTGRTRKENKFSAKRLPTTRLGSFLENRVNEFLRRQNNPEAGEVTV
RVVHASDKTVEVKPGMKSKFVDAGEMAESFPYRTKALFAFEEVDGAELCFFGMHVQEYGS
DCPQPNQRRVYISYLDSVHFFRPKSLRTTVYHEILIGYLEYVKRLGYTAGHIWACPPSEG
DDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPY
FEGDFWPNVLEESIKELEQEEEERKREENTSNESIEVGKGDSKTAKKKNNKKTSKNKSSL
SRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVEPDPLIPCDL
MDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHC
TVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLV
HACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPV
PFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGGVCPPQSLPSPNSAGPSTPTGQQP
PTPQTPQPPPQPPTQQQPPTPNNMSPYSMARAEPPRGISQGKAAGQMTPPTPPQTGPMQQ
QQQIQGPPPAAVEMAMQIQRAAETQRQMAKAQIFPRPIMNPHQMQTMNSMPPMGMNPQQG
PRGPVHMDSGIGPAGMQQPPQQQQPPPPQPQPPWVQGGMPQPQSMQPGMQRSPIMSVPQQ
GQPMNMNPQPGIGQVPGASQTKQGTLPQAALQNLLRTLRSPSSPMQQQQVLNILQSNPQL
LAAFIKQRAAKYASNQNAQAAGNIPRMPSQGGLPQVVHSNPGMQVMNPMQAIGPRPGIPQ
QPQAPQQQPPQQPPIPQQGMAGMNQQGQPVNINHGGISPQFREILLRRQQIMQQQQQQQQ
QLQQQQQQQQQQQLQQQQGAGPGMVNHNQFQQHQVMSGYTQQQQQRFQHHIQMQQGSMGQ
INQMPQGMPGDASSGLQSFQQRLLHQQMGSPAQQNPMSPQQHMLPGPAQSPHLQGQQLPP
SLTNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVGPGQGNPMD
QGHYGSPDPTVMLSQMAGLHGGGVPDLGLGADNSDLNPNLSQSALDIH
NT seq 7527 nt   +upstreamnt  +downstreamnt
atggctgacaatttggtggatcccgggcccccttcagccaagaagcccaagatgtcttct
ccttccctgtcttccagtgatgttccagattttgggtctctctttgacctggaacatgat
ttacctgatgagttgattaactcaagtgagtttggtctgactaatggtggagatctcagt
cagctacacactagtatgaatatggtgcctgatgcagctgccaagcataagcagctttct
gagctcttgcgtggtggaaccacctcaaacatgagcatgggccttgggcaacaaacacca
caaaacagcccaggaataagcctactgaacagtatggtaaaaagtcctatgaaccaagga
ggacatgcatcaccaaacatgggtatgggaggcagtggaaaccctggaccaacagctcag
cagatgaatcccacttcagcaacaggaatgatgtctggtgtgaacagccctgtgaaccag
catggcatgggcatcaacgcaggaatgatagctggaaatggacagaatatgatacaaggt
caaatgatgaacggatctgttggatctggtagaggtcgtcctagcatgcagtaccccaac
cctaacatgggcaatacaggcaacctacttgctgaaacacttcaaggtggacctcaaatt
ggagcacagtctggaatgagaggtccacagccaactgccatgaacaagatgggtctaatg
aacaatcctaatccttatggaacaacgtatggacaaaatgttgttccccagatggggggc
acagttatggcatcacaaatgcagaacaaggcagcattacagaatagcctggctcagttt
ccagtggacaagaaacctggtgttggcatgccaaatatgaatcagcagacgtcgacccag
gtacagcaagctggaatggtcacggcagctccaccgggtatgggagcaggtgcccctcag
ggcattggctcgggagctccaacagcagatcctgagaaaaggaaactgatccagcaacaa
ctggttctactcctgcacgctcacaaatgtcagcggagggaacaggccaatggtgaagta
cggcagtgcaacttaccgcattgccggacaatgaagaatgtcctaaatcacatgacacac
tgccaagctggcaaatcatgccaagttgcacattgtgcctcctcgcggcagattatttcg
cactggaaaaattgcacacgacatgactgtcctgtctgtctgcctctgaagaatgcagga
gacaaacgtaatcaaagtaagagtgacttaaaggagaaggaaaggttaaaactaactttg
ctgggtggtccaccagtgacgctgggagctgctggtgctgtggggacagttggccagcaa
cctgctccttcgattaatgccactaaccaaattgacccaagctcaatcgagcgagcatat
gcagctcttggtcttccataccagggcaatcaattgcagacacaaccacaagctgcagtt
aaaggccagcagtcggggcagtcaccacagggaatgcgctctcttaacacaatgaattca
agcacaatgggagtcaatggaggagtaggtgtacaagcttccagtttgcttcctgacagt
cttttacattcaggaatgaacagtcagagtccaatgatgaatgagagtggtagtgttcct
aacctaggctcaatgcctacggcggctccaccctctagtactggaatccgcaaaccttgg
catgaagatatcacccaggatctgaggaaccatttagtccacaaacttgttcaagccata
ttcccaacacctgatcctgcagcattaaaggatcggcgaatggagaacttggtagcttat
gctcgcaaagtcgaaggggacatgtatgaatctgctaacaacagggctgagtactaccac
tttctggctgagaagatatacaagatccaaaaagagttggaggaaaagcgtcgaaccaga
ttgcaaaagcaacatctaatgcccactccccctggcatgtcccctacacaaatgaatcaa
agccagggaatggcccagccacaaactggaatatcaaccaacggtcctttgccagaccca
agcagcatgatgcgggctaatgtgccaaatcaaatgatgaatcgtatgcagacacaaact
ggaatgaaccaatttggacagatgagtatgccaatgcaatcaatgggccagagacaacag
gctcctattcagcaccctgggcaaatggggcaaacaggccctatgaaccagatgggattt
caggcccgcatgcagcagccgggtactatgcagcaaactgcacagaaccagtttctgtcc
caaaatcagtttcaggcatcttctcctgtgatgaatactggaggaatgaatacaggaggc
atgaatgcatctggcatgcccatgcctcagcctggcaatcagaactccccatctcaggca
cagatgtctaatcctagtcatcctgtgagctctcctgtgatgcctccagcagcagcaggg
aatcagatccactgttcgagtcatgtccagcccatgcaccgcaactcaccgtcccctgct
ccaagccgcacaccaactcctcaccacacgcctccaggcttaacgccgcaaccggctctg
acacctgtacagcctattatacccacagcagcaccgatttcacattcaccactacaacac
agagaaagccctaccccaccacaagtgaccccttccttatccatccctaccccagttatg
cctaccactgagcagcagattcctacaccatctcctcagcagccttcgcagcagtttcca
tcacaacagccaataccacggcctccttcacagccaagcctaaccacatctgtacccacg
ccaactgcaccacaactgccaatgcagcttcacccaagcactccgcctacagccaatctg
gattgcccatcttccaatcctccctctactaatagctctgaagttagctctcagcaacct
gttcaagagcagcaacctccagaggttaaaatggagatcaagcaagaagatgaagatctt
gagcctgagcctatggaacctccagcagaggagaaacctgaggttaaatcagagggagca
gtcgaggattgcaaatctgagccagttgagctggaagagaagaaagaagaagtaaaaaca
gaaatcaaggaggaagatgagaaaccagcaacccctgctgcccagacatctcctgctcct
cctgggcagtccaagaagaagattttcaaacctgaagaacttcgccaggctctcatgccc
actctggaagcattataccgccaagatccagagtcccttccatttcgtcaaccagtggat
gctcagttattaggaatcccgaaaaatacctctgtcctgcaggattactttgagattgtc
aagactccaatggacctttcaactattaaacgcaagttggacacaggacagtaccaagag
ccttggcagtatgtggaagatatttggctgatgttcaacaacgcctggctatacaaccgt
aaaacttctcgcgtctacaagtactgttccaagctggcggaggtgtttgagcaggagatt
gatccagtcatgcaaagcttgggatactgctgtggtaggaagctcgagttttctcctcag
accctttgctgttatggaaagcagctatgtacaattccccgtgatgccacttactacagc
tatcaaaacagttcacccaaatatggccttctcgctgataggtaccacttctgtgaaaag
tgcttcaacgagatccagggggagtgcgtctctcttggtgatgaccccacccaacctcag
accaccatcagtaaagatcagttctccaaaaggaaaaatgacacactggatccagaacaa
tatgtggagtgcttggagtgtggtagaaaaatgcaccagatctgcgtgctgcataatgaa
accatctggcccacaggctttgtatgtgaaggctgtctaaagaaaacaggccgaacccgg
aaagagaacaaattttctgccaagcgacttccaactacaaggcttggctcttttttggag
aacagagtcaatgaattcctgagaaggcagaataatcctgaggctggagaggtgactgtt
cgggtggtccacgcatctgataaaactgtggaagttaaacctggcatgaaatcgaagttt
gtggatgcaggggaaatggcagaatccttcccataccgaacaaaagccttatttgcattt
gaagaggtcgatggagctgaactgtgtttttttggtatgcatgtgcaagaatatggctct
gactgtccccagcccaatcaaaggcgtgtttatatttcctatctggacagtgtacatttc
tttcgcccaaagagccttagaacaactgtgtatcatgagattctcattggctatctggag
tatgtcaaaagactagggtatacagcgggacacatatgggcctgtcctcccagtgaagga
gatgactatatatttcattgtcacccagcggaccagaagatcccaaagcccaaacgcttg
caggagtggtacaagaagatgctggataagtctgtgtctgagcgagtaattcacgattac
aaggacatctttaagcaagcaacagaagaccgactgaccagtgccaaggagctgccatat
tttgaaggggatttctggccaaatgtgctggaagagagcattaaagaactggagcaggag
gaggaagaaaggaagcgggaagaaaataccagcaatgaaagtattgaggttgggaaagga
gacagtaaaactgcaaagaagaaaaacaacaagaagaccagcaaaaacaagagcagcctg
agcagagggagtaagaagaagcctggaatgccaaatgtgtccaatgacctatcacaaaaa
ctctatgctacaatggagaagcataaagaggtattttttgtcatccgccttattgctggt
ccagcggccaattcccttcccccaattgtagagccggaccccctaattccttgtgatctg
atggatggacgggatgccttccttacactcgctagggataaacacttggagttttcatct
ctgcgcagagcgaagtggtctacaatgtgcatgctagtggagcttcatacacagagccag
gaccgctttgtctacacctgcaatgagtgcaagcatcatgttgaaactcgctggcactgt
actgtttgtgaggattatgatttgtgcatcacctgctacaacacaaagacccatgagcac
aaaatggagaaacttgggcttggcttggatgatgaaagcaacaaccaacaagcagcagca
acccaaagccctggagattcccgccggttgagcattcagcgttgcatccagtctcttgta
catgcctgccagtgtcgcaatgcaaactgctctttgccctcatgtcagaagatgaagaga
gtcgtacaacacaccaaaggctgcaagaggaaaaccaatggagggtgtcctatctgcaag
cagcttattgccctgtgctgctaccatgctaaacactgccaagaaaacaagtgccctgtg
cccttctgcctcaatatcaagcaaaagctacgtcaacagcagctacaacataggttgcaa
caggctcagatgctgcgacgtcgtatggccagcatgcagagaactggtggggtttgccct
ccgcagagtttgccttctccaaattcagctggcccttccacaccaacaggccaacagccc
cctactccacagactccacaaccaccaccccaacctccaactcagcagcagcctccaaca
cctaacaacatgtctccctacagcatggcacgtgctgaaccccctaggggcatctcccag
ggcaaagcagctgggcaaatgactcctccaacacctccccagactggaccaatgcagcag
cagcaacagattcagggtccacctccagctgctgtggagatggcaatgcagatacaacgg
gctgcagagacacaaaggcaaatggcgaaagctcaaattttccctcggcccataatgaac
ccacatcagatgcaaactatgaactcaatgccacccatgggaatgaaccctcagcagggc
cctcggggtccagttcatatggattctggcatagggcctgctggaatgcagcaacctcca
caacagcagcagccacctccgcctcaaccacagcctccatgggtgcaaggtggaatgccc
cagccccagtcaatgcaaccgggcatgcaaagatcacctattatgtcagtaccgcagcag
ggacagcctatgaacatgaatccccagcctggcattggacaggtgcctggagcaagccaa
acaaaacaaggcacactgccacaagctgctctgcagaaccttcttcgtactttgcgttct
cccagctcgcccatgcagcagcagcaggttttgaatattttgcaatcaaacccacagctt
ttggctgcctttatcaagcaacgagcagcaaagtatgctagtaatcagaatgcacaggca
gctggcaacattcccaggatgccttcccagggtggccttccgcaggtagtgcattctaat
cctggcatgcaagttatgaaccctatgcaggcaattggcccacgccctggcattcctcag
cagccccaggctcctcaacagcagcctccacagcaaccccctattccccagcaggggatg
gcaggaatgaatcaacaaggtcagccagtaaatatcaatcatggtgggatttcccctcag
ttccgtgagatactcctgcgtaggcagcaaataatgcagcagcagcagcaacaacaacaa
cagctgcagcagcagcaacaacaacaacaacaacagcagctgcagcagcagcaaggagct
ggacctggaatggttaatcataaccaattccagcagcaccaagtcatgtctggctacaca
cagcagcagcaacagcgtttccagcaccatatccagatgcagcaaggaagtatgggacaa
attaatcagatgccacagggaatgccgggtgatgcatcgagtggtctgcagagctttcaa
cagcgcctcttacaccagcagatgggatctccagcacaacaaaatccaatgagcccacaa
cagcacatgttgccaggccctgctcagtcccctcatttacagggacagcagcttcctcca
tcacttaccaaccaagtgcgttctccccaacctgtgccctctccacgtccccagtcacag
cccccacactcaagcccgtctccccgtatgcagcctcagccatcccctcaccacgtttct
cctcagaccagctctcctcacccaggattggtggggcctggacaaggcaaccctatggat
caaggacactacggaagccctgatcctactgttatgctttcgcaaatggcaggtcttcat
ggagggggggtgccagaccttggcctgggtgcagacaactcggaccttaatcccaacctc
tcacagagtgcactagatattcattag

KEGG   Xenopus laevis (African clawed frog): 373795
Entry
373795            CDS       T01010                                 

Gene name
crebbp.L, RSTS, cbp, crebbp, crebbp-a, crebbp-b, kat3a, p300, svip
Definition
(RefSeq) CREB binding protein L homeolog
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04330  Notch signaling pathway
xla04350  TGF-beta signaling pathway
xla04520  Adherens junction
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    373795 (crebbp.L)
   04330 Notch signaling pathway
    373795 (crebbp.L)
   04350 TGF-beta signaling pathway
    373795 (crebbp.L)
   04068 FoxO signaling pathway
    373795 (crebbp.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    373795 (crebbp.L)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    373795 (crebbp.L)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    373795 (crebbp.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    373795 (crebbp.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    373795 (crebbp.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    373795 (crebbp.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     373795 (crebbp.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    373795 (crebbp.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    373795 (crebbp.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    373795 (crebbp.L)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 373795
NCBI-ProteinID: XP_018094738
Xenbase: XB-GENE-6486831
UniProt: A0A1L8EQR2
LinkDB
Position
9_10S
AA seq 2424 aa
MAENLLDGPPNRKRPKLSSPGFSASTDSTDFSFFDLENDLPDELIPNGGELSILGTGGSL
GQDAASQNRQLSDLLRGGNAGLGAAMGRGRSGSPVQQGLGSQGQQHSPGLGNLGSLNKSP
LNQGLSVTSPAGLTKTTGTPGPSVPASQAQKQVSMVAGSTAPSQVPTGLCMNSNFNQGHQ
TLLNSNSGHTLMSQAQPAQGQVLNGSLGVGSRGRGTALQYNSPAMQTNPGSVLAETLTQG
TATMPTHAGMTTAQTGAMNKMGLPGNTSPFGQTFNQAAGQQIRAQGVSPQLPAKPAMANS
LPPFPSDIKNAPVANLPNMSPLQAQVQQVGIGTTPSMGTGPTADPEKRKLIQQQLVLLLH
AHKCQRREQANGEMRDCSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCT
RHDCPVCLPLKNASDKRNQNLPVSLASGVQSPIGTTGGGQQTAPSLSSPNPIDPSSMQRA
YAALGLPYGNPAQGTGQQPAQTQVHQQIRNMNALGGNQMNLTAGGMTVEQQTNLISDTAL
PTALANSNSLLSDGNGQSTVGNHGTMPTAAPPSSTGVRKAWHEHVTQDLRNHLVHKLVQA
IFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRS
RLQKQGIMSSQAPLQAPGAQPTALTQTSPALGQTQPVRPTNGPISMSTVPMNRMQVASGM
NQFSNMPIGNVQMPTAPMGPRAASPLNHPAQINNMGSVPAMAMSPSRMSQPQPIIGAHAG
SMIGPTQTQSQFLQQNQFPASAGTISVGLGQTGAGAAVSQQGQAPSASLPISNSMNMLGP
QTSQLPRPALSQSPLHQTPPSVTASAAVMPPVQHPAPAAMTPPQPTAPAQPSTPLPNPGH
APTPGSVPNAMQSQSTPTVQAAAQTQLTPQPQTPVPVQSVPTPQPAQLQPTSVHAPAPGT
PAAASVDNHVRTPASVASTDNQPAPDHSMTEVKVEVKMGEPEVCENQVEPKTEVEPNAST
QAKESVCEGPEIKSEPMEVEEKKTEIKTENKEEEENGGTNGSLQSTSPSQPRKKIFKPEE
LRQSLMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE
PWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGGKFEFSPQ
TLCCYGKQLCTIPRDAAYFSYQNRYHFCEKCFTEIQGENVTLGDDLSQPQTTISKEQFEK
KKNDMLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCENCLKKTGRTRKENKFCAKRL
QTTRLGNHLEERVNKFLRRQNHPEAGEVSVRVVASSDKIVEVKPGMKSRFVDTGEMPESF
PYRTKALFAFEEIDGVEVCFFGMHVQEYGSDCPMPNTRRVYISYLDSIHFFRPRSLRTAV
YHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDK
AFAERIIHDYKDIFKQATEDRLTSAKELSYFEGDFWPNVLEESIKELEQEEEERKKEEST
AACEIPEGCQGDSKNAKKKNSKKTNKNKSSMSRSNKKKINMPNVCNDLSQKLYATMEKHK
EVFFVIHFYAGPVINSLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTL
CMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCVNCYNLKNHEHKMVKWGLGL
DDESNGQGDAQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCK
RKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQIQHRLQQAQLMRRRM
ATMNTRAVPPQSLPSPTSATPGTPTQQPSTPQTPQPAPQPSPVSIASPGFPSVQRTQPPN
VASQGKPTIPVPPVPPTQPTVQPPPAAVAAARQIELEAQQQQLYRVTGISEGMTNARPGM
VNPSVGSVNPMPQMGMNVPRPGPIGAPPIMSGMQPGQWPAAQLPQQPQMQQSIQRPVMQM
ATPQQAVAGPRLSGVPPQQARNIAPAPNALVDLLRTLKSPSSPQQQQQVLNILKSNPHLM
AAFIKQRTAKYVANQPAMQPQQVPQQQPQQAGMHPQAGLQNMSPMPVGVPRAAVPQQQGQ
GIGLMNTAHNTNLANINPQYREMYHRRQQQQQLLQQQQQQQQQQQQQQSGVGMAGGLPAH
GQFQQPQGAYPQPQALQQQRMQHLSIQGGTMGQISQMAQPGLGNEGSQTSLQHALHQRIQ
QQIKQQIASGQANSMSPQQHLLTGQPPSSHLPTGQQIATALSNQVRSPAPVQSPRPQSQP
PHSSPSPRVQPQPSPHHVSPQTGSPHPGLAASMGNSLDQGHLGNPEQSAMLPQLNPPNRS
ALTNDLSLVGDTSGDTLEKFVEGL
NT seq 7275 nt   +upstreamnt  +downstreamnt
atggctgagaacctgctggacgggccacccaacaggaagagacccaaactgagctccccg
ggcttctctgctagcactgacagcacagacttctccttcttcgacttggaaaatgacctc
cctgatgagctaattcccaatggaggagaactaagcattttaggtactggggggagcctg
gggcaagatgcagcttcccaaaataggcaactgtcagatctcctgcgtggtggaaatgca
gggcttggagcagctatgggcagaggaaggtctggcagtccagtgcaacagggattggga
tctcaaggacaacaacatagccctggacttggaaatcttggcagtctcaacaagagccca
ctcaatcaaggtttatctgtcacttcacccgctggacttaccaagacaactgggacacct
ggtccatctgttcctgcctcccaagcacaaaaacaagttagtatggtggcaggcagcaca
gctccatcacaggtacctacaggcttatgcatgaactccaattttaaccaaggtcatcag
acactgctgaatagtaactctgggcacacactaatgagccaggcccaaccagcacaggga
caggtccttaacggatctttaggtgttggaagcaggggtcgaggaactgcacttcagtac
aactcacctgccatgcaaactaatccaggaagtgtcttggcagaaacattaacacaaggg
acagcaactatgcctactcatgcaggaatgacaactgcacagactggagctatgaataaa
atgggacttccaggcaacactagtccttttggacagacatttaaccaagccgcaggtcag
caaatccgagcccagggagtcagccctcagctacctgcaaagcctgcaatggcaaacagc
cttcctccttttccctctgacatcaaaaatgcacctgttgctaatctacccaatatgtct
cctttgcaggctcaagtgcagcaagttggtattggcacaacgccttccatgggaacaggc
ccaacagctgacccagagaagcgcaagcttatacagcaacaacttgttttactgcttcat
gcacacaaatgtcagcggcgagagcaagcaaatggtgaaatgagggactgctccctgccc
cattgtcgcaccatgaagaacgttcttaatcacatgacccattgccaggccgggaaggcc
tgccaagttgcccactgtgcttcctcaagacaaatcatctctcactggaaaaactgtacg
cggcatgactgtcctgtgtgcttgccattgaagaatgccagtgataagcgcaatcaaaat
ctcccggtttctttagcaagtggagtacaaagccccattggcacaactggagggggccag
cagactgctccttcactaagcagcccgaatcctatagaccccagctccatgcagcgagca
tatgctgctttaggacttccctatgggaatccagctcaaggcactgggcagcagccagcg
cagactcaggttcatcaacagattcgtaacatgaatgcactaggtggaaaccagatgaat
cttacagcgggaggaatgactgttgaacagcaaacaaatctgatctctgacaccgctctg
cccactgccttggcaaactcaaactcattgttgagtgatgggaatggccaaagtacagtt
ggcaaccatggcactatgcctacagcagcacccccctcatctacaggagtgagaaaagca
tggcatgaacatgtgacacaggatctccgtaatcaccttgtacataagctagttcaggcg
atcttccccactccagatcctgcagccctgaaggataggcgcatggaaaacttagtggct
tacgctagaaaagttgaaggagatatgtacgagtcggccaacagcagggatgagtattac
cattttctggctgaaaaaatatataaaatacagaaggagcttgaggagaagcgaaggtca
cgtttgcagaaacaaggaattatgagcagtcaggcacccttacaagcccctggagcacaa
cctacggcccttacacagacatcccctgcactgggacagactcagcctgtgcggccaacc
aacggccctatatccatgtctacggtacctatgaaccgcatgcaggtagcttcagggatg
aaccagttcagtaatatgcccattgggaatgttcagatgcccacagctcctatgggcccc
cgtgcagcctctccactcaaccaccctgcccagataaacaacatgggatcggtgccagct
atggccatgtctccttcccgaatgtcccagccacaacctataataggtgcacatgcaggc
agtatgatagggccgacacaaacacagagccaattcttgcaacagaatcagtttccagca
agcgctggcaccatatctgtgggattgggccagactggagcaggagctgcagtttctcag
cagggacaagcaccgtctgcatctctgcccatcagtaactccatgaacatgttaggccca
cagacgagtcagcttccgagaccagcactttcccagtcaccccttcatcaaaccccacct
tctgttactgcttctgctgctgtcatgccaccagtacagcaccctgctccagctgctatg
acccctccccaacccactgcacctgctcagccatccactccgctgcctaatcctgggcat
gctccaactcctggctctgttcctaatgccatgcagtcacaaagcaccccaacagtgcaa
gcggcggcccaaacgcagctcactccacagccgcaaacacctgtgcccgttcaatcggta
cccacaccacagccggcccagctgcaacctacgtctgtgcatgcaccagctcctggcact
ccggcagcagcaagtgtagataatcatgtgcggaccccagcttctgttgccagcacggac
aaccagccagctccagatcattctatgacagaagtgaaagtagaagtgaaaatgggagag
ccagaggtgtgcgaaaaccaggtggagcccaaaacagaggtggaacccaatgcttccact
caagcgaaggaatcggtttgtgagggtcctgagatcaaatcggagccaatggaagtggag
gaaaagaaaactgaaataaaaacggagaacaaagaagaggaggaaaacggtggcaccaat
ggttctcttcagtccacttcaccgtctcagccacggaagaagatttttaagcctgaagaa
ctgaggcaatctctgatgcccacacttgaagccttatatcgacaggatccagaatcctta
ccctttcgccagcctgttgatcctcagctgcttggaatcccagattactttgacatcgtt
aaaaaccctatggacttgtccactattaaacgaaagctggacactggacagtaccaggag
ccgtggcagtatgtggatgatgtctggctaatgtttaacaatgcctggctgtacaacaga
aagacctcccgggtctataaatactgcagtaagcttgcggaagtctttgaacaggagata
gatcccgtcatgcaatctcttggctattgctgtgggggcaagtttgagttctctcctcaa
acactatgctgctatgggaagcagctctgtaccattccacgtgatgctgcctacttcagc
tatcagaatagataccacttctgtgaaaagtgcttcacagagatccagggggagaatgta
actttaggagatgatctttcacaacctcaaactacaatatccaaggagcaatttgagaaa
aagaaaaatgatatgcttgatccagagccttttgtggactgcaaagagtgtggaaggaag
atgcatcagatctgtgtcctacattatgatattatttggccatctggctttgtctgtgag
aactgcttgaaaaaaacagggagaacaagaaaagaaaacaaattttgtgcaaagaggctc
caaaccacccgactaggaaatcacctagaagagcgagtaaataagttcttgcggagacag
aatcatccagaggctggggaagtgtctgtaagggttgtggccagttcagataagattgtg
gaagtgaaacctggaatgaaatccaggtttgtagacacaggagagatgccagaatccttc
ccataccgtacaaaagctctgtttgcctttgaggagattgatggtgtagaagtgtgtttc
tttggcatgcatgtacaggaatacggctctgactgccctatgcccaacaccagacgggta
tatatctcctatctggacagcattcacttcttcaggccacgcagccttcgaactgctgtg
taccatgagatactcattggttacttggaatatgtgaaaaaacttggctatgtcacaggg
catatctgggcttgcccaccaagtgaaggggacgattacatcttccattgccacccagct
gaccaaaaaatccccaagcctaagcgtctgcaggagtggtataaaaagatgctggacaag
gcttttgctgagcgcattattcatgactataaggatatctttaaacaagcaactgaggat
cgtctcactagtgccaaggaactttcatactttgaaggagatttctggcctaatgtttta
gaggagagcatcaaggaacttgaacaagaagaagaggagagaaagaaggaagagagtaca
gctgcttgtgagatcccagagggctgccaaggagatagcaaaaacgccaagaaaaaaaat
agcaaaaagaccaacaaaaataaaagcagtatgagtcgctccaacaagaaaaaaatcaac
atgcctaatgtttgtaatgatctgagccagaagctctatgccaccatggagaagcataaa
gaggtgttttttgtgattcatttttatgctgggccagttataaattccctcccacccatt
gtggacccggacccactcttgagctgtgacttaatggatggaagggatgcattccttact
ctagctcgtgataagcattgggagttctcatcgctgcgacgttccaagtggtccacactt
tgcatgctggtggaactacacacacaaggccaggaccgctttgtctacacctgcaacgaa
tgcaaacatcatgtcgagacacgttggcactgcacagtgtgtgaggattatgatctgtgt
gtgaactgctacaatttaaagaaccatgagcacaagatggtgaaatggggtcttgggctg
gatgatgaaagtaatggccagggtgatgcacagtctaagagtcctcaggagtcccgtcgg
cttagcattcagagatgcattcagtccttggtgcatgcctgtcagtgtcgcaatgccaat
tgttcccttccctcgtgccagaagatgaagcgggtggtacagcacaccaaaggttgcaag
cgcaagactaacggtggctgccctgtttgcaagcagttgattgccttgtgttgctaccat
gctaagcactgccaagagaacaaatgcccagtgcccttctgtctaaatattaaacaaaag
ttaagacagcaacaaattcaacaccggctgcagcaggctcaacttatgcgacgacggatg
gccactatgaatacccgagctgttcctccgcagagcctcccatcccctacctcagcaact
cctggaacacctacacagcagccgagcaccccacaaactccacagcctgctccacaacca
tctccagtaagcatagcttcaccaggcttccccagtgttcagaggactcagcccccaaat
gtagcatcacagggcaagccaacaattccagttccacccgtgcctcccactcagcccact
gtgcagcccccaccagctgctgtggcagctgcccggcaaatagaacttgaggcacaacaa
cagcagctgtacagggtcaccggcatttcagaagggatgactaatgcacgtcctggcatg
gtcaacccatctgttggatctgtgaaccccatgccgcaaatgggtatgaatgtgccacgc
cctggtcccattggtgcaccccctatcatgtcaggaatgcagcctgggcagtggccggca
gctcagctccctcagcaacctcaaatgcagcagagcatccagcgaccagtgatgcaaatg
gccactccacagcaggcagtcgcaggacctcgtttatcaggcgtaccaccacagcaggca
cgtaatatagcacctgcacctaatgccttggtggatctactgcgtaccctcaagtcacca
agctctccacaacagcagcaacaggtgcttaatattttgaagtccaatccacacctaatg
gcagcttttattaagcaaaggactgctaaatatgtggccaatcagcctgcaatgcagccc
cagcaagtaccccagcagcagccacaacaagctggtatgcatccacaagccggcctgcag
aacatgagccccatgccggttggagtgccgagggcagctgttcctcaacagcagggtcaa
ggcattggtttgatgaacacggctcataatactaacctagcaaatatcaacccgcaatac
cgggagatgtatcatcgacgacaacaacagcaacaactgttgcagcagcagcaacaacaa
caacaacaacagcagcagcaacagagtggagtaggtatggctgggggattgccagcccat
gggcagttccagcaaccccagggagcatacccacaaccacaagccttgcagcagcaacgc
atgcagcatctttctatccagggaggtacaatgggacagatttcacagatggcacagccg
ggccttggcaatgaaggttcacagacaagcctccagcatgctttgcatcaacgtatccag
cagcagatcaagcaacagattgcttcaggacaggctaattctatgagcccacagcaacac
cttctgactggccaacccccctcttcccatttacccactggccaacaaattgcaactgct
ctaagtaatcaggtgcgttcaccagcccctgtccaatcacctcggcctcagtcacagccg
ccacattccagcccttcgccccgtgtacagccgcagccctccccgcaccacgtttcaccc
cagacaggctctccccacccaggcttggcagcctctatgggtaactccctagaccagggt
catttgggaaacccagagcagagcgccatgcttccgcagcttaacccccccaatcgtagt
gccctaacgaatgacttgtccctggtcggagacacttcaggggacaccttggaaaaattt
gttgaagggttgtag

KEGG   Xenopus laevis (African clawed frog): 495689
Entry
495689            CDS       T01010                                 

Gene name
crebbp.S, cbp, crebbp, crebbp-a, crebbp-b, kat3a, p300, rsts
Definition
(RefSeq) CREB binding protein S homeolog
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04310  Wnt signaling pathway
xla04330  Notch signaling pathway
xla04350  TGF-beta signaling pathway
xla04520  Adherens junction
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    495689 (crebbp.S)
   04330 Notch signaling pathway
    495689 (crebbp.S)
   04350 TGF-beta signaling pathway
    495689 (crebbp.S)
   04068 FoxO signaling pathway
    495689 (crebbp.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    495689 (crebbp.S)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    495689 (crebbp.S)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    495689 (crebbp.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    495689 (crebbp.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    495689 (crebbp.S)
   03029 Mitochondrial biogenesis [BR:xla03029]
    495689 (crebbp.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     495689 (crebbp.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    495689 (crebbp.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    495689 (crebbp.S)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    495689 (crebbp.S)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 495689
NCBI-ProteinID: NP_001088637
Xenbase: XB-GENE-6253475
UniProt: Q5U248
LinkDB
Position
9_10L
AA seq 2428 aa
MAENLLDGPPNRKRPKLSSSGFSASTDSTDFSFFDLENDLPDELIPNGGELSILGTGGNL
GQDAASQNKQLSDLLRGGNAGLGAAMGRGGSGSPVHQGMGSQQNSPGLGNLSNLNKSPLN
QGLSVTPPSGLTKTTTGTPGPSVPASQAQKQVSMVAGSPAAPQAPTGICMNSNFNQGHQA
LLNSNSGHTLINQAQPAQGQVLNGSLGVGSRGRGTALQYNSPGMQTNPGSVLAETLTQGT
ATMPTHAGMTTAQSGAMTKMGLPGNTSPFGQTFNQAAGQQIRAQGVNPQLPAKPAMANSL
PSFPSDIKNAPAANVANMAQVQQVGIGTTPSMGTGPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEMRDCSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNASDKRNQNLPVSLASGVQNPIGTAGAGQPTAPSLSSPNPIDPSSMQRAYAALG
LPYGNQAQSTGQQSAQTQVHQQIRNMNALGGNQINLTAGGMAVEQQTNLISEAALPTALT
NSNSLLSDGNSPSTVGNLGTMPTAAPPSATGVRKAWHEHVTQDLRNHLVHKLVQAIFPTP
DPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLQKQ
GIVSSQTPLQAPGTQPTALTQTTAALGQTPSVRPTNGPISMSTVPTMNRMQVASGMNQFS
SMTIGNVQMPTAPMGPRAASPLNHPTQMNNMGTVPAMAMSPSRMSQPQTIIGAHAGSMIG
PTQTQSQFLQQNQFPASTGTISVGLGQTGAAAAVSQQGQAPTASLPISNSMNMLGPQTSQ
LQRPALSQSPLHQTPPSVTVSAVMPPVQHPAPAAMTPPQPTAPAQPSTPLPTPGQTPAPM
PGSVPNSMQSQSTPTVQAAAQTQLTPQPSTPVPIQSVPTPQPAQLQPTSVHAPAPGTPLS
QAAASVDNHVRTPASVASTENQPAPDHIMTEVKVECKMEEPEVCENQVEPKTEVEPEAPS
QVKETVSEGPEMKSEPMEVEEKKTEIKTENKEEEENGGANSSLQSTSPSQPRKKIFKPEE
LRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE
PWQYVEDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEQEIDPVMQSLGYCCGRKFEFSPQ
TLCCYGKQLCTISRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQSQTTISKEQFEK
KKNDMLDSEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFCAKRL
QTTRLGNHLEDRVNKFLRRQNHPEAGEVSVRVVASSDKIVEVKPGMKSRFVDTGEMPESF
PYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPMPNTRRVYISYLDSIHFFRPRSLRTAV
YHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDK
AFAERIIHDYKDIFKQATEDRLTSAKELSYFEGDFWPNVLEESIKELEQEEEERKKEEST
AACETIEGCQGDSKNAKKKNNKKTNKNKSSMSRSNKKKIIMPNVCNDLSQKLYATMEKHK
EVFFVIHFYAGPVINSLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTL
CMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCVNCYSAKNHEHKMVKWGLGL
DDESNGQGDAQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCK
RKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQIQHRLQQAQLMRRRM
ATMNTRAVPQQSLPSPTSATPGTPTQQPSTPQTPQPAPQPSPVSKASPSFPSVQRTQTPI
VASQGKPTNPVPPVPPSQPTVQPPPAAVAAARQIELEAQQQQLYRVTGIAEGMTSARPGM
VNPSVGSVNPMQQMGMNVPRPSPIGAPPIIAGMQPGQWPAAQLPQQPQMQQNIQRPVMQM
ATAQQAVAGPRLAGVPPQQARNIAPAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPHLM
AAFIKQRTAKYVANQPAMQPQQAPQQQPQQPGMHPQAGLQNMSPMPVGVPRAAVPQQQPG
MTPQGQGIGLMNTAHNTNLANMNPQYREMYHRRQQLLQQQQQQQQQQQQQSGVGMAGGLP
AHGQFQQPQGAYPQPQALQQQRLQQQHLSIQGGTMGQISQMAQPGLGNEGSQASLQHALH
QRIQQQIKQQIASGQANAMSPQQHLLTGQPPSAHLATGQQIATALSNQVRSPAPVQSPRP
QSQPPHSSPSPRVQPQPSPHHVSPQTGSPHPGLAASMANSLDQGHLGNPEQSAMLPQLNP
PNRSALTNDLSLVGDTSGDTLEKFVEGL
NT seq 7287 nt   +upstreamnt  +downstreamnt
atggccgagaacctgctggacgggccacccaacaggaagagacccaaactgagctcatca
ggcttctctgctagcactgacagtacagacttttccttctttgacttggaaaacgacctc
cccgatgaactaattcccaatggaggagaactaagcattttgggtactggggggaacctg
ggtcaagatgcagcttcccaaaataagcaactgtccgatctcctacgtggtggaaatgca
gggcttggtgcagctatgggcagaggaggctctggcagtccagtgcatcagggaatggga
tcccaacaaaatagccctggacttggaaatcttagcaatcttaacaagagcccactcaat
cagggcctatctgtcactccaccctctggacttaccaagacaacaacggggacacctggt
ccatctgttcctgcctcccaagcacaaaaacaagttagtatggtggcaggcagcccggct
gctccacaggcacctacaggcatctgcatgaactccaatttcaaccaagggcatcaggct
ctgctcaatagtaactctgggcacacactaataaaccaggcccagccagcacagggacag
gtcctcaatgggtctttaggtgtgggaagcagaggtcggggaactgccctacagtacaac
tcacccggcatgcaaactaatccaggaagtgtcttggcagaaacattaacacaagggaca
gcaaccatgccaactcatgcaggaatgacaactgcccagagcggagccatgactaaaatg
ggacttccaggcaacactagtccttttgggcagacatttaaccaagccgctggtcagcaa
atccgagcccaaggagtcaaccctcagctgcctgcaaagcctgccatggcaaacagcctt
ccttcttttccttctgacatcaaaaatgcacctgctgctaatgttgccaatatggctcag
gttcagcaagttggtattggcacaacgccatccatgggaactggcccaacagctgacccg
gagaagcgcaagcttatacagcaacaacttgtcctactgcttcatgcgcacaagtgtcag
cggcgagagcaggctaatggtgaaatgagggactgctccctgccccattgtcgcaccatg
aagaacgtgcttaatcacatgacccattgtcaggccgggaaggcttgccaagttgcccac
tgtgcttcctcaagacaaatcatctctcactggaaaaattgtacgcggcatgactgtcct
gtgtgcctgccattaaagaatgccagtgataagcggaatcagaatctcccagtttcttta
gcaagtggagtacaaaaccccattgggacagctggagcaggccagcctactgctccttca
ttaagcagcccaaatcctatagatcccagctccatgcagcgagcatatgctgcgctcgga
cttccctatgggaatcaggctcaaagcacggggcagcagtcagcgcagactcaggttcat
cagcagattcgtaacatgaatgcactaggtggtaaccagataaatcttacagcgggagga
atggctgttgaacagcaaacaaatctgatctctgaagctgctctgcccactgccttgaca
aactcaaactcattgctgagtgacgggaacagcccaagtacagttggtaaccttggcact
atgcctacagcagcacccccttcagctacaggagtgagaaaagcatggcatgaacatgtg
acccaggatctccgcaatcaccttgtacataagctagttcaggcgatcttccccactcca
gaccctgcagccctgaaggaccggcgcatggaaaatttagtggcatatgctagaaaagtg
gaaggagatatgtatgagtcagccaacagcagggacgagtattatcatttactggctgag
aaaatatataaaatacaaaaggaacttgaggagaagcgaaggtcgcgtttgcagaaacaa
ggaattgtgagcagccagacacccttacaagcccctggaacacaacctacagcccttaca
cagaccacagctgcactgggacagactccatctgtgcggccaaccaatggcccaatctcc
atgtctacagtacctactatgaaccgcatgcaggtagcttcagggatgaaccagttcagt
agtatgaccattgggaatgttcaaatgcccacagctcctatgggtccccgtgcagcatct
ccactcaaccaccctacacagatgaacaacatgggaacggtaccagctatggccatgtct
ccatcccgaatgtcccagccgcagactataataggtgcacatgcaggcagtatgataggg
ccgacacaaacacagagccaattcttgcaacagaatcaattcccagcaagcactggcacc
atatctgtgggactggggcagactggagcagcagctgcagtttctcagcagggacaagca
cccactgcatctctgcctatcagcaactcaatgaacatgttgggcccacagacgagtcag
cttcagcgaccagcactttcccagtcgccccttcatcaaactccaccttctgttactgtt
tctgccgtcatgcccccagtacagcaccctgctccagctgctatgacccctccccaaccc
actgcacctgctcagccatccactccgctgcctactcctgggcagacacctgctccaatg
cctggctctgttcctaattccatgcaatcacaaagcaccccaacagtgcaagcagcagcc
caaacgcagctcactccacagccgtcaacacctgtgcccattcagtctgtacccacgcca
caacctgctcagctgcaacctacgtccgtgcatgcaccagctcctggcactccgttatca
caggcagcagcaagtgtagacaatcatgtgcggaccccagcttctgttgccagcactgaa
aaccagccagctccggatcatattatgacggaagtgaaagtagaatgcaaaatggaggag
ccagaggtgtgtgaaaaccaagtggagcccaaaacagaggtggaaccagaagctccatct
caagtgaaggaaactgtgagtgagggtcctgagatgaaatcggagccaatggaagtggag
gaaaagaaaactgaaataaaaacggagaacaaagaggaggaagaaaacgggggcgccaac
agttcccttcagtccacttcaccttctcagccgcggaagaagatttttaagcctgaagaa
ctgcgccaagctctgatgcccacacttgaagccttatatcgacaggatccagaatcctta
ccctttcgtcagcctgttgatcctcagctgctgggaataccagattactttgacattgtg
aaaaaccctatggacttgtccaccattaaacgaaagcttgacactggacagtaccaggag
ccatggcagtatgttgaggatgtctggctaatgtttaacaatgcctggctgtacaataga
aagacctcccgcgtctacaaatactgcactaagcttgccgaagtctttgaacaggagata
gatcccgtcatgcagtctcttggctattgttgtgggcgcaagtttgagttctctcctcaa
acactatgctgctatgggaagcagctctgtaccatttcacgtgatgctgcctactacagc
tatcagaatagataccacttctgtgaaaagtgcttcacagaaatccaaggggagaatgta
actttaggagatgatccttcccaatcgcaaacgacgatatccaaggagcaatttgagaaa
aagaaaaacgatatgcttgactcagagccttttgtggactgcaaagagtgtggaaggaag
atgcatcagatctgcgtcctgcattacgatattatttggccatctggctttgtctgtgat
aactgcttgaaaaaaacagggaggacacgaaaagaaaacaagttttgtgcaaagaggctc
caaaccacccggctaggaaatcacctggaagatcgagtgaataagttcttgcggagacag
aatcatccagaggctggggaagtgtccgtaagggttgtggcaagttcggataagattgtg
gaagtgaaacctggaatgaaatccaggtttgtagacactggagagatgcctgaatccttc
ccataccgtacaaaagctctgttcgcttttgaggagattgatggtgtagacgtgtgtttc
tttggcatgcacgtacaagaatacggctctgactgtcctatgcccaacaccagacgggta
tacatctcctatctggacagtattcacttcttcaggccacgtagccttcgaactgctgtc
taccatgagattctcattggttacttggaatatgtgaaaaaacttggctatgtcacaggg
catatctgggcctgcccaccaagtgaaggggacgactacatcttccattgccatccggct
gaccaaaaaatccccaagcctaagcgtctgcaggagtggtataaaaagatgctggacaag
gcttttgctgagcgcatcattcatgactataaggacatctttaagcaagcaaccgaggat
cgtctcactagtgccaaggaactttcatattttgaaggagatttctggcctaatgtgtta
gaggagagcatcaaggaacttgagcaggaagaagaggagagaaagaaggaagagagtaca
gctgcttgtgagaccattgagggctgccaaggagatagcaaaaatgccaagaaaaaaaat
aacaaaaagaccaacaaaaataaaagcagtatgagtcgctccaacaagaaaaaaatcatc
atgcctaatgtttgtaacgatctcagccagaagctctatgccactatggagaagcataaa
gaggtgttttttgtgatccatttctatgcggggccagttattaattccctcccacccatt
gtggacccggacccactcttgagctgtgacctaatggacggaagggatgcattcctgact
ctagcccgtgataagcactgggagttctcatctctgcgacgttccaagtggtccactctt
tgcatgctggtggaattacacacgcaaggccaggaccgctttgtctacacctgcaatgaa
tgcaaacatcatgtggagacacgctggcactgcacagtatgtgaggattatgatctgtgt
gtgaactgctacagtgcaaagaaccatgagcacaagatggtgaaatggggtcttgggctg
gatgatgaaagtaacggccagggtgatgcacagtctaagagtccacaggagtcccgtcgg
cttagcattcagagatgcatccagtccttggtgcatgcctgtcagtgtcgcaatgccaat
tgttcccttccctcgtgccagaagatgaagcgggtggtacagcacaccaagggatgcaag
cgcaagacgaatggtggctgccctgtttgcaagcagttgattgccttgtgttgctaccat
gctaagcactgccaagagaacaaatgcccagtgcccttctgtctaaacattaaacaaaag
ttaagacagcaacagatccaacaccggctgcagcaggctcaacttatgcgacgacggatg
gccactatgaatacacgagctgttccgcagcagagcctcccatcccctacctcagcaaca
cctggaacacctacacagcagccgagcaccccgcaaactccacagcctgctccacaacca
tctccagtaagcaaagcttccccaagcttccccagtgttcaaaggactcagactccaatt
gtagcatcacagggcaagccaacaaatccagttccacctgtgcctccctctcagcccact
gtgcagcccccaccagctgctgtggcagctgcccggcaaatagaattagaggcacaacag
cagcagctgtacagggtgaccggcattgcagaagggatgactagtgcacgtcctggcatg
gtcaacccatctgttggatctgtgaaccccatgcagcaaatgggtatgaatgtgccacgc
cccagtcccattggtgcaccccctatcattgcaggaatgcagcctgggcagtggccggca
gctcaactccctcagcaacctcaaatgcagcagaacatccagcgaccagtgatgcaaatg
gccactgcacagcaggcagttgcaggacctcgtttggcaggcgtacccccacagcaggca
cgtaatatagcacctgcacccaatgccttgcaggatctgctgcgtaccctcaaatcacca
agctctccacaacagcagcagcaggtgcttaatattttgaagtccaatccacacctaatg
gcagcttttattaagcaaaggactgctaaatatgtggccaatcagcctgcaatgcagccc
cagcaagcaccccagcagcagccgcaacaacctggcatgcatccacaagctggcctgcag
aacatgagccccatgccggttggagtgccgagggcagctgttcctcagcaacagccaggt
atgactccacaaggtcaaggtattggcttgatgaacaccgctcataatactaacctggca
aatatgaacccgcagtaccgggagatgtatcatcgacgacaacaactgttgcagcagcaa
caacaacaacaacagcagcagcaacagcagagtggagtaggtatggctgggggattgcca
gcccatgggcagttccagcaaccccagggagcatacccgcaaccacaagccttgcaacag
caacgcctgcagcagcagcatctatctatccagggaggtaccatgggacagatttcacag
atggcacagccgggacttggcaatgaaggttcacaggcaagtctccagcatgctttgcat
caacgtatccagcagcagatcaagcaacaaattgcttcaggacaggctaatgctatgagc
ccacagcaacaccttctgactggccaacccccctctgcccatttagccactggccagcaa
attgcaactgctctaagtaatcaggtgcgctcaccagcccctgtccaatcacctcggcct
cagtcacagcctccacattccagcccttcaccccgtgtacagcctcagccctccccgcac
catgtttcaccccagacaggctctccccaccctggcttggcagcctctatggctaactcc
ctagaccagggtcatttgggaaatccagagcagagcgccatgcttccgcagctcaacccc
cccaatcgtagtgccctaacaaatgacttgtcccttgtcggagacacttcaggggacacc
ttggaaaaatttgttgaagggttgtag

DBGET integrated database retrieval system