KEGG   Xenopus laevis (African clawed frog): 108714512Help
Entry
108714512         CDS       T01010                                 

Definition
(RefSeq) procollagen galactosyltransferase 2-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00310  Lysine degradation
xla00514  Other types of O-glycan biosynthesis
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108714512
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    108714512
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xla01003]
    108714512
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     108714512
Glycosyltransferases [BR:xla01003]
 O-Glycan biosynthesis
  O-linked Gal type
   108714512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 108714512
NCBI-ProteinID: XP_018114297
UniProt: A0A1L8GNS2
LinkDB All DBs
Position
4L
AA seq 615 aa AA seqDB search
MATIPAGYTLLLLLPFCLTNLCVSAEELNIEEAILPESSLQKPSVLIAIIARNAAHTLPY
FMDCIDKLNYPKSRIAIWAATDHNIDNTTAILREWLKSVQKLYHYVEWRPMAEPQSYPDE
LGPKHWPASRFTHVMKLRQAAMRTAREKWSDYILYIDADNFLTNPQTLNLMLSENKTIVA
PMLESRTLYSNYWCGITPQGYYKRTPDYVLIREWKRLGCFPVPMVHSTMLIDLRKEASKN
LQFYPPHEDYTWAFDDIIVFAFSSRQTGIQMYICNREHYGYLAVPMKPHQTLQDDIDNFV
HVQTEAMIDRPPLEPSRYVHVPPKHPDKMGFDEIFMINLKRRQDRRVRMLRSLYEQEIQV
KIFDAVDGKALNTSQLKALKIEVIPGYHDPYSGRTLTRGEIGCFLSHYYIWKEVVDRGLE
KSLVIEDDVRFEPLFKHKLMKLMNDIEEVELEWDLIYIGRKRMQVERPEKAIPNVMNLVE
ADYSYWTLGYAISRQGAEKLIAAEPFNKMLPVDEFLPVMFNKHPVEKYLEFYEPRDLKAF
SAEPLLIYPTHYTGQPGYFSDTETSTIWDNETVVTDWDRRYSLKSREQGQIHSDAQNKDA
LPPQPTLQTSSRDEL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatccctgctggatatacccttctgctgctattgcctttctgtctaacaaac
ttatgtgttagtgctgaggagctgaatatagaagaagcaattctccctgaatcttccctg
caaaagcccagtgtcctgattgccatcatcgctaggaatgctgcacacacgctgccttat
tttatggactgcattgataagttgaattaccccaagagcagaatcgctatatgggcagca
actgatcacaacattgataacaccacagctatattacgagaatggctaaagagtgtgcag
aagttgtatcattatgttgaatggagacctatggcagagcctcaatcataccctgatgaa
cttgggccaaaacactggccagcttctagatttacccacgtcatgaaactgcgccaagcc
gcaatgcgtactgccagagaaaagtggtctgattatatcttgtatatagatgcagacaac
tttctaaccaatccccagactttaaatctgatgctgagcgaaaacaagactattgttgcc
ccaatgcttgaatcacggacactctactctaattattggtgtggaatcacacctcagggt
tattataaaagaactccagactatgttctcataagagagtggaagagattgggctgtttc
cctgttccaatggttcattcgactatgctcattgacctcaggaaagaggcatccaaaaac
ctacaattttatcctcctcatgaagactacacctgggcatttgatgacattattgtcttt
gcattctctagcagacaaacaggaattcaaatgtatatctgtaacagagagcactatggg
tatcttgctgttccaatgaaacctcatcaaaccctgcaggatgacatagataattttgtt
catgtgcagacagaagcaatgattgatcgcccccctctggaaccatctcggtatgtccac
gtgccacccaaacatccagataaaatgggatttgatgagatttttatgatcaacttgaag
cgacggcaggatcgcagagtacgtatgcttcgaagcctatatgaacaggaaatccaagtg
aaaattttcgatgctgttgatggaaaagcactgaatacaagccaactgaaggcattgaaa
atagaggtgatacctggatatcacgacccatactctggtagaaccctgacacggggtgaa
attggttgcttccttagccattattatatatggaaagaggtggttgacaggggccttgaa
aaatcactcgtcattgaggatgatgttcggtttgagcctttatttaaacacaagctaatg
aagttaatgaatgacattgaagaggttgaactggagtgggacttgatctacattggaaga
aagcgaatgcaagtcgagcgcccagaaaaggcaattccaaatgtaatgaatctggttgag
gcagactactcatactggacccttggatatgccatatccaggcaaggagcagagaagcta
attgcagcagaaccttttaataagatgttaccagtggatgagttcctcccggtcatgttc
aacaaacacccagtagagaaatatttggagttttacgaacctcgagatttgaaggccttc
tctgctgagcctctgcttatctacccaacccactacactggccaaccagggtattttagt
gacacagagacatccaccatctgggacaatgaaacagtagtaactgattgggatcgaagg
tactctttgaaatctagagagcagggtcagatacacagcgacgctcagaacaaggacgct
ttaccgcctcagccaacacttcaaacttcatcacgggatgaactataa

DBGET integrated database retrieval system