KEGG   Xenopus laevis (African clawed frog): 108715128
Entry
108715128         CDS       T01010                                 

Gene name
rela.S, Xrel1, xrela
Definition
(RefSeq) v-rel avian reticuloendotheliosis viral oncogene homolog A S homeolog
  KO
K04735  transcription factor p65
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04137  Mitophagy - animal
xla04210  Apoptosis
xla04218  Cellular senescence
xla04620  Toll-like receptor signaling pathway
xla04621  NOD-like receptor signaling pathway
xla04622  RIG-I-like receptor signaling pathway
xla04623  Cytosolic DNA-sensing pathway
xla04625  C-type lectin receptor signaling pathway
xla04920  Adipocytokine signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108715128 (rela.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108715128 (rela.S)
  09143 Cell growth and death
   04210 Apoptosis
    108715128 (rela.S)
   04218 Cellular senescence
    108715128 (rela.S)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108715128 (rela.S)
   04621 NOD-like receptor signaling pathway
    108715128 (rela.S)
   04622 RIG-I-like receptor signaling pathway
    108715128 (rela.S)
   04623 Cytosolic DNA-sensing pathway
    108715128 (rela.S)
   04625 C-type lectin receptor signaling pathway
    108715128 (rela.S)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108715128 (rela.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108715128 (rela.S)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108715128 (rela.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108715128 (rela.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108715128 (rela.S)
SSDB
Motif
Pfam: RHD_dimer
Other DBs
NCBI-GeneID: 108715128
NCBI-ProteinID: XP_018115458
Xenbase: XB-GENE-17345727
UniProt: A0A1L8GCQ8
LinkDB
Position
4S
AA seq 309 aa
MEEDIEVVFVLGKWEARGIFSQADVHRQVAIVFRTPAFQHTQIRQTVKVQMQLRRPSDKE
VSETMEFQYLPDEADPHHIEEKRKRTLDSFKHYVKKNPFAGGETRPQRRIAVANRNVPTK
SEPLTASIRPSMSVPNPGVPSLPFSMPVLKAENVASPLTLRSTVNISDFSNLGFSSQPPP
QSDHERLESILNYPSFPNVDLVEMLPNETESRCTSLSSIDNSDFSQLLSESQTSGTLSAA
LQEPGTSQGTLMSYPQSIARLMTNRPNEDDGGERIDSGLINGIFDIQPGGESLASLFDLD
ISSLINNMK
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaggaagatattgaggtggtattcgttctgggcaaatgggaagctcgtgggatattt
tcccaagcagatgttcaccgtcaggtagccattgtcttcagaacacctgcttttcaacac
acacaaatacggcagactgtcaaagtgcaaatgcagctgaggcggccgtcggataaagaa
gtcagtgagacaatggagtttcagtatcttccagatgaagctgacccccaccatattgag
gaaaaacggaaaaggacccttgacagtttcaagcattacgtgaagaagaatccttttgca
ggaggagaaacacgaccccaacgcagaattgctgtggcaaatcgtaatgtgccaacaaag
tcagagcctttaacagcatccataagacccagcatgtcggttccaaatccaggggtgccc
tctcttccattctccatgcccgttttaaaggctgagaacgtggcttcacctttgactctt
cggtccaccgtcaacatcagcgacttcagcaatctaggattttcatcacagcctccccct
cagtctgatcacgaacgcttagaatccattttaaactacccctcattcccaaatgtggat
ttagtagaaatgttgccgaatgagacggagagccgttgtaccagtttgagttctattgac
aatagtgactttagccagcttctcagcgagtcacaaacatctgggacactctccgcagct
ttacaagagcctggaactagtcaaggtacactcatgtcttatcctcaatccattgctcgg
cttatgaccaaccggcccaatgaggatgatggcggcgagagaattgacagtggcctaatt
aatgggatttttgacattcaaccaggaggagagtctttagcctcgttatttgatcttgac
atatcttctttaataaataacatgaaataa

DBGET integrated database retrieval system