KEGG   Xenopus laevis (African clawed frog): 108715442
Entry
108715442         CDS       T01010                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04136  Autophagy - other
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04371  Apelin signaling pathway
xla04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108715442
   04068 FoxO signaling pathway
    108715442
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108715442
   04136 Autophagy - other
    108715442
   04137 Mitophagy - animal
    108715442
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108715442
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108715442
   04121 Ubiquitin system [BR:xla04121]
    108715442
   03029 Mitochondrial biogenesis [BR:xla03029]
    108715442
Membrane trafficking [BR:xla04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108715442
Ubiquitin system [BR:xla04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108715442
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108715442
SSDB
Motif
Pfam: Atg8 APG12 Rv2175c_C
Other DBs
NCBI-GeneID: 108715442
NCBI-ProteinID: XP_018116080
UniProt: A0A1L8GF62
LinkDB
Position
4S
AA seq 150 aa
MGGAGEPRRPEPEVSSEGGSALLLLSSLSSVGTMKWMFKEDHSLEHRCVESAKIRAKYPD
RVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQS
SLTMGQLYEKEKDEDGFLYVAYSGENTFGV
NT seq 453 nt   +upstreamnt  +downstreamnt
atgggaggtgctggggaacccagacgccctgaaccggaagtgtcgtcagaaggcggctcc
gccctattgttattgtcgtcgctgtcatcggtcggtaccatgaagtggatgttcaaggaa
gaccattcgctggaacacaggtgtgtggagtcagcgaaaatcagagccaagtatccagat
cgagttccggtaattgtcgaaaaggtttcaggctcccagattgtagatattgataaacgg
aagtacttggttccatccgatattactgtggcccagttcatgtggataatccgaaaacgg
attcagttgccatcagagaaagcaatcttcttgtttgtagacaagactgtgccacagtct
agcctcacaatgggacaactttatgagaaagaaaaagacgaggatggattcttatatgtg
gcctacagtggagagaacacatttggcgtttga

KEGG   Xenopus laevis (African clawed frog): 414477
Entry
414477            CDS       T01010                                 

Gene name
gabarap.L, GABAA, gabarap, mm46
Definition
(RefSeq) GABA(A) receptor-associated protein L homeolog
  KO
K08341  GABA(A) receptor-associated protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04136  Autophagy - other
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04371  Apelin signaling pathway
xla04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    414477 (gabarap.L)
   04068 FoxO signaling pathway
    414477 (gabarap.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    414477 (gabarap.L)
   04136 Autophagy - other
    414477 (gabarap.L)
   04137 Mitophagy - animal
    414477 (gabarap.L)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    414477 (gabarap.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    414477 (gabarap.L)
   04121 Ubiquitin system [BR:xla04121]
    414477 (gabarap.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    414477 (gabarap.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    414477 (gabarap.L)
Ubiquitin system [BR:xla04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   414477 (gabarap.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    414477 (gabarap.L)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 414477
NCBI-ProteinID: NP_001084530
Xenbase: XB-GENE-6252840
UniProt: Q6NUG7
LinkDB
Position
3L
AA seq 117 aa
MKFVYKEEHAFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGM
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtataaagaggaacatgccttcgagaaacgccgctctgagggcgagaaa
atccgcaagaaatatcccgaccgagtcccggttattgtggagaaggcgcccaaagccaga
ataggagatctggacaagaagaaatacctggtaccctccgaccttacagtcggacagttt
tacttcctgatcagaaagagaattcacctccgggcagaggacgctctcttcttctttgtc
aataatgtcatccccccaaccagcgccaccatgggccagttgtaccaggagcaccacgag
gaggatttcttcctgtatattgcctacagtgatgagagtgtatatggcatgtga

KEGG   Xenopus laevis (African clawed frog): 443979
Entry
443979            CDS       T01010                                 

Gene name
gabarapl1.L, apg8l, atg8, atg8l, gabarapl1, gabarapl1-a, gabarapl1.S, gec1
Definition
(RefSeq) GABA(A) receptor-associated protein like 1 L homeolog
  KO
K08341  GABA(A) receptor-associated protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04136  Autophagy - other
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04371  Apelin signaling pathway
xla04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    443979 (gabarapl1.L)
   04068 FoxO signaling pathway
    443979 (gabarapl1.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    443979 (gabarapl1.L)
   04136 Autophagy - other
    443979 (gabarapl1.L)
   04137 Mitophagy - animal
    443979 (gabarapl1.L)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    443979 (gabarapl1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    443979 (gabarapl1.L)
   04121 Ubiquitin system [BR:xla04121]
    443979 (gabarapl1.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    443979 (gabarapl1.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    443979 (gabarapl1.L)
Ubiquitin system [BR:xla04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   443979 (gabarapl1.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    443979 (gabarapl1.L)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 443979
NCBI-ProteinID: NP_001085553
Xenbase: XB-GENE-6077975
UniProt: Q6GQ27 A0A1L8FEA0
LinkDB
Position
7S
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaaattccagtataaggaggatcatcctttcgaatacaggaagaaagagggagagaag
atcagaaagaaatacccggatcgggtgcctgttattgtagaaaaagcgcctaaggccaga
gttccagacctggacaagaggaaatacctggtaccctcagatctaacagttgggcaattt
tacttcctcatcaggaagaggattcaccttcgccctgaggatgccctcttcttcttcgtc
aacaataccattcctcccaccagcgcaactatggggcagctgtatgaggataaccacgag
gaggactacttcctgtatgtggcctacagtgatgagagcgtgtatggaaagtga

KEGG   Xenopus laevis (African clawed frog): 494762
Entry
494762            CDS       T01010                                 

Gene name
gabarapl1-b
Definition
(RefSeq) GABA(A) receptor-associated protein like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04136  Autophagy - other
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04371  Apelin signaling pathway
xla04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    494762 (gabarapl1-b)
   04068 FoxO signaling pathway
    494762 (gabarapl1-b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    494762 (gabarapl1-b)
   04136 Autophagy - other
    494762 (gabarapl1-b)
   04137 Mitophagy - animal
    494762 (gabarapl1-b)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    494762 (gabarapl1-b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    494762 (gabarapl1-b)
   04121 Ubiquitin system [BR:xla04121]
    494762 (gabarapl1-b)
   03029 Mitochondrial biogenesis [BR:xla03029]
    494762 (gabarapl1-b)
Membrane trafficking [BR:xla04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    494762 (gabarapl1-b)
Ubiquitin system [BR:xla04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   494762 (gabarapl1-b)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    494762 (gabarapl1-b)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 494762
NCBI-ProteinID: NP_001088067
UniProt: Q6GQ27 A0A1L8FEA0
LinkDB
Position
7L
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaaattccagtataaggaggatcatcctttcgaatacaggaagaaggagggcgagaag
atcagaaagaaatacccggatagggtgcctgttattgtagaaaaggcccctaaggccaga
gttccagacctggacaagaggaaatacttggtaccctcagatctaacagttgggcaattt
tacttcctcatcaggaagaggattcaccttcggcccgaggatgccctcttcttcttcgtc
aacaataccattcctcccacaagcgcaaccatggggcagctctatgaggataaccacgag
gaggactactttctgtacgtggcctacagtgatgagagcgtgtatggaaagtga

KEGG   Xenopus laevis (African clawed frog): 734814
Entry
734814            CDS       T01010                                 

Gene name
gabarapl2.L, atg8, gabarapl2, gate-16, gate16, gef2
Definition
(RefSeq) GABA(A) receptor-associated protein like 2 L homeolog
  KO
K08341  GABA(A) receptor-associated protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04136  Autophagy - other
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04371  Apelin signaling pathway
xla04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    734814 (gabarapl2.L)
   04068 FoxO signaling pathway
    734814 (gabarapl2.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    734814 (gabarapl2.L)
   04136 Autophagy - other
    734814 (gabarapl2.L)
   04137 Mitophagy - animal
    734814 (gabarapl2.L)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    734814 (gabarapl2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    734814 (gabarapl2.L)
   04121 Ubiquitin system [BR:xla04121]
    734814 (gabarapl2.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    734814 (gabarapl2.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    734814 (gabarapl2.L)
Ubiquitin system [BR:xla04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   734814 (gabarapl2.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    734814 (gabarapl2.L)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 734814
NCBI-ProteinID: NP_001089750
Xenbase: XB-GENE-952425
UniProt: Q3B8F6
LinkDB
Position
4L
AA seq 117 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGV
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaagaccattcgctggaacacaggtgtgtggagtcggcaaaa
atcagagccaagtatccagatcgggttccggtcattgtggaaaaggtttcaggctcccag
attgtagatatcgataaacggaagtacctggttccatccgacattactgtggcccagttc
atgtggataatcagaaaacggattcagttgccatcagagaaagcaattttcttgtttgta
gacaagactgtgccacagtctagcctaacaatgggacaactctatgagaaagaaaaagac
gaggatggattcttatatgtggcctacagtggagagaacacatttggcgtttga

DBGET integrated database retrieval system