KEGG   Xenopus laevis (African clawed frog): 108715479
Entry
108715479         CDS       T01010                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
xla04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108715479
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108715479
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108715479
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    108715479
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108715479
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    108715479
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 108715479
NCBI-ProteinID: XP_018116145
UniProt: A0A1L8GLB4
LinkDB
Position
4S
AA seq 313 aa
MTAKASHSVLYQWKGVLLTCLSGSDPKRRKEMSRQTATAIPTGTSKCPPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEVTLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacggccaaggcgagccacagcgtgttgtaccagtggaaaggggtgctgctcacgtgc
ttgtcaggtagtgacccgaagagaaggaaagaaatgagccgacagactgctacagcaatc
cctactggtacctcaaagtgtcctccctctcagagagttccagccctgactggcacaact
gcttcaaacaatgacttggccagcctctttgaatgcccagtgtgttttgactatgtttta
ccacctatacttcaatgtcagagtggccacctggtctgcagtaattgtcggccaaagctc
acttgctgcccaacctgcagaggccctttgggatcaattcgcaacttggctatggaaaaa
gtcgccaactctgtgctgtttccatgtaaatatgcctcgtctggttgtgaggtaactttg
ccgcatactgaaaaagctgaccatgaagagctttgtgagtttaggccttactcctgtccc
tgccccggggcttcgtgtaaatggcaaggttccttggatgcggtgatgccacacttaatg
catcagcataaatctattacaacgttacaaggagaggatattgtatttcttgccacagac
ataaaccttcctggtgcagtagactgggtcatgatgcagtcttgttttggctttcatttc
atgttagtcttggaaaaacaggagaaatatgacggccatcagcagttctttgcaattgta
cagctcataggaacacgcaagcaggccgagaactttgcttaccgactggagcttaacggc
caccggcggagattgacttgggaagcaacacctcgctctattcatgagggaatcgcaact
gccatcatgaatagtgactgcttagtatttgacaccagcattgcacaactatttgctgaa
aatggcaatttaggaataaacgttacaatctccatgtgctga

KEGG   Xenopus laevis (African clawed frog): 443864
Entry
443864            CDS       T01010                                 

Gene name
siah1.L, siah, siah1
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1 L homeolog
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
xla04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    443864 (siah1.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    443864 (siah1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    443864 (siah1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    443864 (siah1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     443864 (siah1.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    443864 (siah1.L)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 443864
NCBI-ProteinID: NP_001085438
Xenbase: XB-GENE-1014421
UniProt: Q6GQJ5
LinkDB
Position
4L
AA seq 282 aa
MSRQTATAIPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTEKADHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagccgacagactgctacagcaatccctactggtacttcaaagtgtccaccatctcaa
agagttccagccctgaccggcacaactgcttcaaacaatgacttggccagtctctttgaa
tgcccggtgtgttttgactatgttttaccccctattcttcaatgtcagagtggccatctg
gtctgcagtaattgtcggccaaagctcacttgctgcccaacctgcagaggtcctttggga
tcaattcgcaacttggctatggaaaaagtcgccaactctgtgctattcccttgcaaatac
gcctcgtctggttgtgaggtaactttgccgcacactgaaaaagctgaccatgaagagctg
tgtgagtttaggccttactcctgtccctgccccggggcttcgtgtaaatggcaaggttcc
ttggatgcggtgatgccacacctaatgcatcagcataaatctataacaacgttacaagga
gaggatattgtatttcttgccacagacataaaccttcctggggcagtagactgggtcatg
atgcagtcttgttttggctttcatttcatgttagtcttggaaaaacaggagaaatacgac
ggccatcagcagttctttgccattgtacagctcataggaacacgcaagcaggccgagaac
tttgcctaccgactggagcttaacgggcacaggcggagattgacttgggaagcaactcct
cgctctattcatgaagggatcgcaactgccattatgaatagtgactgcttagtatttgac
accagcattgcacaactgtttgctgaaaatggcaatttaggaataaacgttacgatctca
atgtgctga

DBGET integrated database retrieval system