KEGG   Xenopus laevis (African clawed frog): 108716606Help
Entry
108716606         CDS       T01010                                 

Definition
(RefSeq) protein kinase C delta type-like
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04140  Autophagy - animal
xla04270  Vascular smooth muscle contraction
xla04621  NOD-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04912  GnRH signaling pathway
xla04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108716606
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108716606
   04625 C-type lectin receptor signaling pathway
    108716606
  09152 Endocrine system
   04912 GnRH signaling pathway
    108716606
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108716606
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108716606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108716606
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108716606
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108716606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Seadorna_VP7 Pkinase_fungal Kdo FTA2 RIO1
Motif
Other DBs
NCBI-GeneID: 108716606
NCBI-ProteinID: XP_018118345
LinkDB All DBs
Position
5L
AA seq 225 aa AA seqDB search
MILRDGNLPMSRIIFYTAEMVVALQFLHSKGIIHRDLKPDNVLVDKDGHIKICDFGLAKE
NIDGQRKNYGLAGTRGYRAPEVLLQDEYNAAVDWWSFGVIMYEMATGKLPYSTSGSILNQ
TYAIMTETPDYPSYMSEEMLDLLSKLLESDDTKRIGLNGNIREHPFYSTINWDDLENRRL
ETPFQPGMPSADDFYDFPLPFSTHNCNGKNLKDFSEVDPNWNWQE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgattcttcgtgacggaaatctcccaatgtcgagaatcatattctacacagcagagatg
gtggttgccctccagttcctgcattctaagggaatcattcatcgtgatctgaagccggac
aacgtattagtggataaagacggccacataaagatctgcgactttggccttgcaaaagag
aacatcgatggccagaggaagaactacggcttagcaggaacccgtggatatcgggcacca
gaggttctattacaggatgagtacaatgcagccgtggattggtggtctttcggggtgata
atgtatgaaatggccacaggtaaattgccatattcaacatcaggcagcattctaaatcag
acctatgcgattatgacggaaacaccagattacccatcttatatgagcgaggaaatgctg
gacctcctgtctaagcttttggagagtgatgacaccaaacgaattggactgaatgggaac
atcagggagcatcctttctacagcactatcaactgggatgatctggaaaatcgaagactg
gagacaccttttcagccaggaatgccatctgcggacgacttctatgactttccgctgcca
ttctccactcataattgcaatggaaagaatttaaaagatttctcagaagttgatcccaac
tggaattggcaggagtaa

DBGET integrated database retrieval system