KEGG   Xenopus laevis (African clawed frog): 108716665Help
Entry
108716665         CDS       T01010                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108716665
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108716665
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108716665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 108716665
NCBI-ProteinID: XP_018118462
UniProt: A0A1L8G820
LinkDB All DBs
Position
5L
AA seq 224 aa AA seqDB search
MLCRLSVCGRGKLRCVPALAYCSSREKHTLPDLPYDFGALQPHISAEIMQLHHSKHHATY
VNNLNITEEKYAEALAKGDVTSQVSLQAALKFNGGGHINHTIFWTNLSPNGGGEPQGELL
DAIKRDFGSFEKFKEKFNTVSVGVQGSGWGWLGYNKDSNRLQLAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYRASKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcaggctcagtgtttgtggcaggggaaagctgagatgcgttccagccttggca
tactgttcctccagggagaagcatactctgcctgacttgccctatgattttggtgctctg
cagcctcacatcagtgctgaaattatgcagctacaccacagtaaacaccatgctacctat
gtaaacaacctaaatattactgaggaaaaatatgcagaggccttggctaaaggggatgtt
acatctcaagtctctcttcaagctgcacttaaatttaatggtggtggccatatcaatcac
acaatcttctggacaaacctttcccctaatggtggaggggagccacaaggagaacttcta
gatgccataaagcgagactttggctcctttgagaagtttaaggaaaaattcaatactgtg
tcagttggagtccagggatcagggtggggatggctgggttataacaaggactctaataga
cttcagctggctgcctgtgccaatcaagaccctctacaaggaacaacaggtcttatccct
ctgcttggaatcgatgtgtgggagcatgcttattacttgcaatataaaaatgtcagacca
gactatttgaaagcgatctggaatgttatcaactgggagaatgtcaccgaaagatatcgg
gcttccaaaaaataa

DBGET integrated database retrieval system