KEGG   Xenopus laevis (African clawed frog): 108716832Help
Entry
108716832         CDS       T01010                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2-like
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04140  Autophagy - animal
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108716832
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108716832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108716832
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108716832
Protein kinases [BR:xla01001]
 Serine/threonine kinases: Other
  CAMKK family
   108716832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108716832
NCBI-ProteinID: XP_018118801
UniProt: A0A1L8I1C0
LinkDB All DBs
Position
1L
AA seq 556 aa AA seqDB search
MSSCVSKRASSERSILQDDHETTIQPHIVCNFSTLSIDLGMESVIVVTEYDPTITESEQN
GQSRHQDDEFKEYSGVEHDLHRMNESGGKIDEHNVLPVSHNDCKGKLNMTNRKLSLQERS
QSTPTSSNSLGMNGRYIYPSLPYSPVTSPQSSPRLPRRPTVESHRVSITGCQDCVQLNQY
QLKDEIGKGSYGVVKLAYNEDDNMYYAMKVLSKKKLMRQAGFPRRPPPRGAKTATEGGIQ
AMGPIERVYQEIAILRKLDHQNVVKLIEVLDDPSEDHLYMVFELVKRGPVMDIPTTKPLT
EDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLLGDDGHIKIADFGVSNTFEGNDAFLS
NTVGTPAFMAPETLSETRKIFSGKALDVWAMGVTLHCFVFGQCPFMDESILTLHSKIKNQ
PLEFPDQHDISEDLKDLMLHMLDKNPESRISVPELKLHPWVTKHGLEPLPTEDENCTLVE
VTEEEVENSIKHVPSLATVILVKSMLRKRSFGNPFEGSRKEERSMSSPGNLLMIQGSEES
LRESDLQEVGEDEVLS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgcgtgtccaaaagggcttcttctgagaggtccatcctacaagatgatcat
gagactacaattcaacctcacatagtctgtaacttttcaaccctgagcattgacctaggc
atggaatcagttatagtggtaacagaatatgatccaactatcactgagtctgagcagaat
gggcagtccagacatcaagatgatgaattcaaggagtatagtggagtggagcatgacctg
catagaatgaatgaaagtggaggcaagattgatgagcataacgtgcttccagtatcccat
aatgattgtaaaggcaaactcaacatgaccaatagaaaactctcccttcaagaacgatct
cagtctactcctacttctagtaatagcctaggaatgaatggacgatatatttatccttca
ctgccctactctccagttacatccccacagtcctctcctcgtctgccacgaagaccaacc
gtagagtctcaccgggtttccatcacaggttgtcaggattgtgtccaactgaaccaatac
cagttaaaagatgaaattgggaagggctcctatggggtggtaaaactggcctataatgaa
gatgataacatgtactatgcaatgaaggttctttcaaagaaaaagcttatgagacaagca
ggatttccacgccgcccccctcccagaggtgccaaaacagctactgaaggtggtattcag
gccatggggcccattgaaagagtctaccaggaaattgctattctcaggaagctggatcat
caaaatgtagtcaagctgattgaggtgctggatgaccctagcgaggaccatctgtacatg
gtgtttgagctggtgaagcgtggaccagtgatggacattccaacaaccaaaccattaact
gaagaccaagctcgcttctacttccaggatctgattaaaggaatagaatatttgcattat
cagaagattatacaccgtgacatcaagccgtctaacctcttgctgggagatgatgggcac
attaagatcgccgactttggtgtcagtaatacattcgaagggaatgatgcctttctgtcc
aacacagtggggacacctgcattcatggctcctgaaaccctgtctgagacccgcaaaata
ttctcaggaaaggcactggatgtttgggcaatgggtgtgactctacactgttttgtgttt
ggtcagtgcccatttatggatgaaagcattctaaccctacacagcaaaataaagaatcag
ccactggagtttcctgaccagcatgacatctcagaagatctaaaagacctaatgttgcac
atgcttgacaagaatccagaatctaggatttctgtccctgaattaaagcttcacccgtgg
gtcaccaagcatggactggagccactaccaacagaggatgaaaactgcacattggtggaa
gtgacagaggaagaggtggagaattcaatcaagcatgtcccaagcttggccactgtgatc
ttggtaaaatcaatgcttcggaaacgctcttttgggaatccatttgaggggagcaggaaa
gaagaaagatccatgtcctctccaggaaatctgctaatgatacaaggaagcgaggagagt
ttgcgagagagtgatttacaggaggtaggagaggatgaagttttatcctga

DBGET integrated database retrieval system