KEGG   Xenopus laevis (African clawed frog): 108717032Help
Entry
108717032         CDS       T01010                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00052  Galactose metabolism
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108717032
   00500 Starch and sucrose metabolism
    108717032
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     108717032
    3.2.1.20  alpha-glucosidase
     108717032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 108717032
NCBI-ProteinID: XP_018119233
UniProt: A0A1L8GAR4
LinkDB All DBs
Position
5L
AA seq 2695 aa AA seqDB search
MGKKRKFSSLEITLIVLFIIMTIVAIVLVTLFATGQSGVRNSTGDPPFEPQCQNININDR
IDCIPEEVASQEICIQRGCCWSPHELINVPWCFFTNAHGYEVKGTKDTKAGFEANLQRLP
APMVYENNIEELLLTAEKQSNNRFRFKITDPKNKRFEVPHEHIKDFTGSAASNTNYDFNL
IHKPFGIQVMRKSNSRILFDSTIGPLLYADQVLQLSIKLPSSNIYGLGEHVHRQYKHDTY
WKKWAIFTRDEFPNGDGYNLYGAHTFFLCLEDTDGSSFGVFLMNSNAMEVTVQPAPAITY
RTIGGILDFYVFVGNSPEQVVMEYLELIGRPYMPAYWTLGFHLSRWGYKSLDEVKQVVER
NRAIGIPYDVQFTDIDYMEDRKDFTYDKVKFKDLPSFAEDLHAHGQRYIIILDPAVANTP
LIDGPYVAYERGNNLGVWVNESDGVTPLVGEVWPGITVFPDYTNEACTKWWVQECVDFYK
QVPYDGIWIDMNEVSNFVRGSNKGCANNKLNYPPYTPRIKDRVMYSKTLCMDAKQAWGLH
YDVHNLYGYSMVLSTEEAIKAVFPGKRSIIFSRSTFAGAGKYSGHWLGDNAANWNDIKWA
IPGMFEFSLFGIPYIGADICGFFDDSPEELCRRWMQVGAFYPFSRNHNAENYKHQDPASY
GADSLLVNSSRHYLNIRYTLLPYLYTLFYKAHTKGETVVRPLLHEFYSDPETWGIDNQFL
WGPGLLITPILNPNSVTANVYIPDAKWYNYETGTQASWRKQKVDMYIPEDKIGLHVRGGY
IFPTQKPANTTFYSRKNALGLIIALDDNQSAKGDFFWDDGESRGAIESGTHILYEFSVSN
NILDMLVTNAKYTDPNNLKFEEIKIYGVQKFVSEVRVKKGGVIQSSSHTVKYDSNKVLEI
TGLQLVLGEGYTLEWDQIDKAFEKYDCHPETDAYEAKCQSRGCIWEPSDIPKEPWCYFPS
NYGYRVGNVQPTSTGIKVEISKGSMVVPPYGDLSPPISPINVDVIYHENNMLQFKIYDPN
NKRYEVPVPLNLPNSPTSTEAQRLYEVTVKDNPFGLQIRRKSNGAIIWDSQVPGFYFSDM
LLRISTRLPSHYVFGLGEVEHNTFRHNLNRTTIGLFSKDQPPQEHTNSYGVHPFYMAMEN
DGSATGVLLLNSNAMDVTLQPTPALTYQTIGGILDFYMVLGPTPELVVQQYTALIGRPVM
PAYWALGFQLCRYGYQNDAEISNLYNEMKRAQIPYDVQYADIDYMERQMDFTLGADFTGL
PALVDNIRSEGMRFIILLDPAIAGNETKPYPAFTRGVADDVFIKWDDGSGIVWGKVWPDL
PGVVVDESLDWDTQVKIYRAHAAFPDFFLDRTAKWWHQEIKEYRENHIRFDGLWIDMNEP
ASFVHGSVDGCRNNILNFPPYMPKLESSHQGLSHKTLCMESQQHLPNGNPVRHYDVHSLY
GWSHSKPTFDALRNITGERGIVISRSTYPTSGQWVGHWLGDNTAAWNQMDKSVIGMMDFS
LFGISYTGADICGFFEDSTYELCARWMQLGAFYPFSRNHNGKGWRRQDPVSFDSAFEDLS
RKVLNIRYTLLPYLYTLLFEANTKGSTVVRPLLHEFTEDKQTWDVYKQFLWGPALMISPV
MDEGARTVNVYIPNTIWYDYHTGVNVNIKGQWAELQAPLDHINLHVRGGYILPLQAPANN
THFSRKNPMKLLVALDQNEMANGQLFWDDGISITSIESGVYTMYEFSAGPNFVSMTTTHA
NYTDPNNVMFEEIQIHGLTKNIIDLVVKKNGTVQPSNHQVIYDSNTQIAKITGLQLILGE
SYYLEWNTYLSRFDCYPEDNPSKEACENRGCLWDVASIPQVPACFYPSNNGYTVTNVQTN
ENGLTADLQNTVPVPRYKNGSSPIQTLRLTVIYHENNMLQFKIDDPNNKRYEVPVPIKTP
SSPTSTQEQRMYNVEIVNNPFGIKIIRKNSGTVIWNSQVPGFTFSDQFIQISTILPSGYI
YGLGETEHRSYRHDLNWVTWGMFAKDQPPGYTLNAYGVHPFYLGLENDGNAHGVFLLNSN
AMDVTLQPTPALTYRTVGGILDFYVVMGSTPEMVVQQYTALIGRPVLPAYWSLGFQLCRY
GYQNNKEIEDLYNEMVAAQIPYDVQYADIDYMERQMDFTLGQNFSGLPAVVDKMRSDGMK
VIIILDPAIAVNETKDYPPYRRGIEKDVFIKWADGSGIALGKVWPDLPGVIVDQSLDWDT
QVAIYRAHTAFPDFFKNSTSEWWLQEIKDFYQNVLKFDGIWIDMNEPANFVHGTVDGCKD
AQLNKPPYMPRLESKGQGLNHKTLCMDTQQILPDGSPVRHYDVHNLYGWSHAKPTYDALK
SVTGERGIVVSRSTYPSAGQWVGHWLGDNTAAWNQVDKSIIGMMEFNLFGIPYIGADICG
FFENTTYELCARWMELGAFYPYSRNHNGKGFMRQDPVSFDENFKTLSRNVLNIRYKLLPY
LYTLMFEAHTEGTTVIRPLLHEFTAEKTTWDIYKQFLWGAAFMISPALEIHQLVVKAYIP
NTRWYDYHTGVQVNERGTWVDLNTPIEHINLHVRGGYIIPWQEPAKNTFYSRQKFMGLIV
ALDDQGQAQGNLFWDDGKSIDSIEKKQYLLTKFTADKTTVKNEILHNAYVTTANPLHLGH
VYIWGAGNSVKSVTVTYGGSVETITSFTLQNQVLEIHLVNKQYNLAEQIEVAWQI
NT seq 8088 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaagcggaagtttagttcgttggaaatcaccctcattgtgctattcattatc
atgacaattgtggctattgtgcttgtcacactgtttgctacaggacaatctggtgtcaga
aatagtaccggggatcctccatttgagccccaatgtcaaaacataaatatcaatgacagg
atagactgtatcccagaagaagttgcttctcaggaaatctgcatacaaaggggctgctgt
tggagtcctcacgaattaattaatgttccatggtgcttttttacaaatgctcatggttat
gaagtgaagggaacaaaagataccaaagcaggatttgaagcaaatctacaaaggctgcct
gctcccatggtgtatgaaaacaacattgaagaattactcctaacagcagaaaaacaatca
aataatcgatttagattcaagattactgaccctaaaaacaagcgatttgaagttccccat
gaacacataaaagactttacaggttcagctgcatcaaatacaaattatgacttcaacctg
atacacaaaccttttggaatccaagtgatgagaaaatcaaattccagaattctgtttgat
tctacaatcgggccacttctttacgctgaccaagtcttgcagctctccattaaattacca
agttctaacatttatggcttgggggaacatgttcacagacagtataaacatgatacgtat
tggaaaaaatgggctatatttacaagagatgaatttcccaatggtgatggatataactta
tatggtgcacacacattttttctgtgtttggaagatacagatgggtcttcttttggagtt
ttcttaatgaacagcaatgctatggaagtaacagttcagccagcaccagcaattacatac
cgaactataggaggcatccttgatttctacgtctttgtaggaaacagtccagagcaagta
gtaatggaatacttagaacttattggaagaccatatatgcctgcatattggacacttggc
tttcatttgagtcgctggggctacaagtctcttgatgaagtaaaacaagtggtggaacga
aacagagccatcggaataccatatgatgttcagtttactgacattgactatatggaagac
agaaaagattttacctatgacaaggttaagtttaaagaccttccctcatttgctgaagat
ttgcatgcccatgggcagagatatatcatcatactggatcctgccgttgccaatactcca
cttattgatggaccttatgtagcctatgaacgaggaaataatctaggagtatgggttaat
gagtcagatggggtaacaccacttgttggagaggtttggcctggaattacagtatttcct
gattatactaacgaggcatgcactaaatggtgggtgcaggaatgcgttgacttttacaaa
caggtgccatatgatggaatttggattgatatgaatgaagtgtcgaactttgtgagaggc
tcaaacaaaggatgtgctaataataagctaaactatcctccatacacaccaagaattaag
gatcgtgtgatgtattccaagactttgtgcatggatgcaaaacaggcatggggattgcat
tatgatgttcacaacttatatggatattcaatggttctatctactgaagaagccatcaaa
gctgttttccctggaaaaagaagcattattttttctcgctcaacttttgctggagcaggc
aaatattcaggacattggcttggagataatgctgccaactggaatgatattaaatgggct
ataccaggaatgtttgagttcagtctttttggaataccttatattggtgcagacatatgc
ggcttttttgatgactcgccagaagaactctgcagaaggtggatgcaagttggtgctttt
tatccattctccagaaaccacaatgctgagaattacaagcaccaggatcctgcttcttat
ggagctgattcacttttagtgaactcctcaaggcactacttaaatattcgctataccttg
ttgccatatctttacaccttgttctacaaggctcacaccaaaggagaaactgtagtgagg
ccactacttcatgagttctattctgatcctgaaacttggggaatagataaccaatttttg
tggggtccaggacttctcattacacctatacttaatcccaactcagttactgctaatgta
tatatacctgatgcaaagtggtacaactatgaaactggcactcaagcttcttggagaaag
caaaaagttgacatgtatataccagaagacaaaattggacttcatgtcagaggaggatac
atattcccaactcagaaaccagctaacactaccttctacagccgtaaaaatgcacttggc
cttattattgctttggatgataaccagtctgccaagggagactttttctgggatgatgga
gaatccagaggggcaatagaatcagggacccatattttatatgaattttctgtttcaaat
aatatattagacatgttggtcactaatgcaaagtatacagacccaaacaatctaaaattt
gaagaaattaagatatatggagttcaaaaatttgtcagtgaagtaagagtgaagaaagga
ggtgttatccaatcctctagtcatacagttaaatatgattcaaacaaggttttagaaata
acaggtcttcagctggtattaggagagggttacactctggaatgggatcaaattgataag
gcctttgaaaagtatgattgccaccccgaaactgatgcttatgaagctaaatgtcaaagc
cgaggatgtatctgggagccttcagatatacccaaagagccatggtgttactttccgagt
aactatggttacagagtgggcaatgtgcagccaacctctactggtataaaagtggaaatt
tccaaaggttccatggtggtaccaccttatggtgatctttcacctcccatcagcccaatt
aatgttgacgtaatatatcatgaaaacaacatgctgcaatttaagatctatgatcccaat
aacaaaagatatgaagttcctgtaccactaaatctaccaaatagccctacaagtacagaa
gcacaacgcctttatgaggttacggttaaagataatccatttggactccagatcagaaga
aaaagcaatggagcaataatatgggattctcaagttcctggattttacttctcagacatg
ttgctacgtatttcaacaaggctgccctcacattatgtttttggacttggagaagttgaa
cataatacatttcggcacaatttaaataggacaactattggactgttttctaaagatcaa
cccccacaagagcacaccaactcttatggtgttcatccattctacatggctatggaaaat
gatggaagcgctactggtgtacttctactaaacagcaatgcaatggatgtaacactccaa
ccaactccagcactaacatatcaaaccattggaggaatattggacttttatatggttttg
ggtccaacacctgagttagttgtgcaacagtacactgcacttattggacgtccagttatg
ccagcttattgggctcttggatttcagctctgccgctatggctatcagaatgatgcagag
atttctaacctttacaacgaaatgaaaagagctcaaattccttatgatgtgcagtatgct
gatattgactacatggaaagacagatggattttacacttggcgctgattttacaggactt
cctgctttggttgataacataagatctgaaggaatgagatttatcatccttttggatccc
gctattgcaggcaatgaaacaaaaccttatccagcttttaccagaggtgtagcagatgat
gtatttatcaaatgggatgatgggagtggaattgtttggggaaaggtatggccagaccta
ccaggtgtagtagttgatgaatcattagactgggatacacaagtaaagatttatagagct
catgctgcattcccagactttttccttgatcggacagctaagtggtggcatcaagaaatt
aaagaataccgtgaaaatcatataagatttgatggactctggatagatatgaatgaacca
gccagttttgttcatggaagtgttgatggctgcagaaataacattttgaattttccacca
tatatgccaaaattggagtccagccatcaagggttaagtcacaaaacgttgtgcatggag
agtcaacaacacctgccaaatggaaatcccgtaaggcactatgatgttcatagtctctat
ggatggtcacattcaaaaccaacctttgatgctctaagaaatataacaggtgagagaggt
atcgttatcagtcgctctacatatccaacatctggacaatgggttggacattggctaggg
gataatactgctgcatggaatcaaatggataaatcagttataggaatgatggattttagt
ctttttggaatatcatatactggagccgatatttgtggattctttgaagattcaacatat
gaattatgtgctcgatggatgcagttaggagcattttaccccttttcaagaaatcacaat
gggaaaggatggagaagacaagatcctgtaagttttgattcagcatttgaagacctttcc
agaaaagtcctaaatataagatatactctgttaccctacttgtacactctgttatttgag
gctaacactaaaggctccactgttgttcgaccattattacatgaattcactgaagataaa
caaacctgggatgtgtataaacagtttttatggggtccagcattgatgataagccctgtt
atggatgaaggcgctagaactgtaaatgtgtatatcccaaatacaatatggtatgattat
cacacgggagtcaatgtcaatataaaaggccagtgggcagagctacaagcaccgcttgat
catataaatcttcatgttcgaggtggctacatattacctttgcaagctccagctaacaat
actcattttagccgaaaaaatccaatgaaactacttgtggctttagaccaaaatgaaatg
gccaatgggcaacttttctgggatgatggaataagtattacctcaattgaaagtggggtg
tacaccatgtatgaattttctgctggtccaaattttgtaagcatgacaacaacgcatgcc
aactatactgatccaaacaatgtgatgtttgaagaaattcaaatacatggacttaccaag
aatataattgaccttgtggtgaaaaagaatggcactgtacaaccttcaaatcatcaagtt
atttatgattcgaatacacagattgcaaaaataacaggtcttcaattgatactcggagaa
tcatattatttggaatggaatacctatctttctagatttgactgctatccggaagacaac
ccttctaaagaagcatgtgaaaaccgtggctgcttatgggatgtagccagcattcctcaa
gtaccagcttgtttctacccaagcaataatggatatactgttaccaatgtgcaaaccaat
gaaaatggtttaacagcagatctgcagaatacagtacctgttcctcgttataagaatggc
tcttcccccatacagactcttcgattaacagttatctatcacgaaaataatatgcttcag
ttcaagattgatgatcctaacaacaagagatatgaagttccagtaccaataaaaacacca
agcagtccaacaagcacacaagaacagcgaatgtataatgttgaaattgttaacaacccc
tttgggataaaaataattaggaaaaactctgggacagttatttggaactctcaagttcct
ggattcaccttctcagaccagtttattcaaatttcaactatacttccctctggatatatt
tatggacttggagaaactgaacacagatcatatcgtcatgacttgaattgggttacttgg
ggaatgtttgccaaagaccaacctccagggtatactttaaatgcatatggtgtgcatccc
ttttacttgggcctggaaaatgacggcaatgctcatggagtttttctgcttaacagcaat
gcaatggatgtaaccctgcagccaactccagcactgacttatcgcacagttggaggaatt
ctagacttttatgtagtgatgggttcaactcctgagatggtcgttcaacagtacacagca
cttattggacggcctgttttgccagcatattggtctctgggatttcagttatgccgttat
ggataccaaaataacaaagaaattgaagatctgtataatgaaatggttgcagctcaaatt
ccctatgatgtgcaatatgccgatattgactacatggaaaggcaaatggatttcacttta
ggccagaatttttcagggcttcctgctgtagttgacaaaatgagatcagatggaatgaaa
gtcatcattattttggatcctgctattgcagtaaatgaaacaaaagattatccaccttac
agaagaggaattgaaaaagatgtttttattaaatgggcagatggaagtggaattgcattg
ggcaaggtctggccagatttgcctggtgtcatagttgatcaatcacttgattgggataca
caagttgcaatttacagagctcatacagcatttccagactttttcaagaattccacatcg
gagtggtggcttcaagaaatcaaagatttttaccaaaatgttctgaaatttgatggcata
tggatagatatgaatgaacctgccaactttgtacatggcacagttgatgggtgcaaagat
gctcagttgaataagcctccatacatgccacgtttggaatcaaaaggtcagggtttaaat
cacaagacattgtgcatggacactcaacaaattctcccagatggatctcctgttagacac
tatgatgtccacaatctctatggatggtcacatgcaaaaccaacatatgatgctctgaaa
agtgttactggggaaagaggtattgttgtgagtcgttctacatatccttcagctggacag
tgggtgggacattggcttggggataacactgctgcatggaatcaggttgataagtctatt
attggtatgatggaatttaacctttttggaataccctatattggggcagatatttgtgga
ttctttgaaaacactacttatgaattgtgtgctcgttggatggagctgggagccttttat
ccctattccagaaatcacaatggaaaaggtttcatgagacaagatcctgttagctttgat
gaaaactttaagactctctccagaaatgtccttaatatcagatacaagcttttgccatat
ctgtacacactaatgtttgaggcccatacggaaggaactactgtaatacgacctttgttg
catgaatttactgcagaaaaaacaacctgggatatctataaacagttcttatggggagct
gcatttatgatcagcccagcacttgaaatacatcagttagtagtaaaggcatatatacca
aacacccgctggtatgactatcacacgggtgtccaagttaacgagagagggacatgggtt
gatttaaatactcccattgaacatattaatttacacgtaagaggtggatacatcatacca
tggcaggaaccagctaaaaatactttttacagccggcagaagtttatgggactaattgtt
gcactggatgaccagggccaagcacaggggaaccttttctgggacgatggaaaaagtatt
gattcaatagaaaagaaacaatatctgctaacaaaattcactgctgataagaccacagta
aagaatgaaatactacacaacgcttatgtaacaacagcaaatcctcttcatcttggacat
gtttatatttggggagctggcaattcagtaaaaagtgttacagttacatatgggggctct
gtagagaccattacaagttttaccttgcaaaaccaggttttagaaatccatcttgttaat
aagcaatataacctggcagaacaaattgaagtggcatggcaaatctaa

DBGET integrated database retrieval system