KEGG   Xenopus laevis (African clawed frog): 108717252
Entry
108717252         CDS       T01010                                 

Gene name
adcy3.L
Definition
(RefSeq) adenylate cyclase 3 L homeolog
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla01100  Metabolic pathways
xla04020  Calcium signaling pathway
xla04114  Oocyte meiosis
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04371  Apelin signaling pathway
xla04540  Gap junction
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108717252 (adcy3.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108717252 (adcy3.L)
   04020 Calcium signaling pathway
    108717252 (adcy3.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108717252 (adcy3.L)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108717252 (adcy3.L)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108717252 (adcy3.L)
   04914 Progesterone-mediated oocyte maturation
    108717252 (adcy3.L)
   04916 Melanogenesis
    108717252 (adcy3.L)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108717252 (adcy3.L)
   04270 Vascular smooth muscle contraction
    108717252 (adcy3.L)
Enzymes [BR:xla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108717252 (adcy3.L)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Pilin_N
Other DBs
NCBI-GeneID: 108717252
NCBI-ProteinID: XP_018119608
Xenbase: XB-GENE-6488059
UniProt: A0A1L8GC45
LinkDB
Position
5L
AA seq 1119 aa
MEKMPRNRAFSEPEYSAEYSADYSVSLPSDAEHGVGRTHEVTVRSSGCCLCLPRFMRLTF
APESLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYSSDKLASTLVAAVGLLA
HLLLFVLCKFGLLPDRISRKFVPYILWILIAAQIFSYLGLNFAHFHEASDTVGWQAFFVF
SFFITLPLRLTPIVLITTVSCGIHTLVLGVTIAQQQQDSINGNALLRQILSNVAIYLCSI
SVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLNDMKK
DQEQKELQQFNTMYMYRHENVSILFADIVGFTQLSSYCSAQELVKLLNELFARFDKLAAK
NHQLRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVDAISYVREKTKTDVDMRVGVHS
GTVIGGVLGQKRWQYDVWSTDVTLANKMEAGGIPGRVHISQSTYDCLKGEFEVEPGEGGT
RCDYLREKGIVTYLVVVPKQPINKNGINGVKLSLTSSHGNTPQLINTKECNGSIHTTCTT
PDENEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQQNEQELNKLLNEALLERETVQVLK
GKYTYRLSMRFINPEMETRFSVEKEKQSGAAFSCSCVVLLFTAIVQILIDPMLVANYVTF
VIGEILLLVLTICSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVDM
LSCLQYYSTLNMTSHDQEAWGCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMLMITI
AAGVVNIYAWRPIFDDYDNKRFNGYLALLVPSKYSMTVMIFIMMISFYYFARHVEKLART
LFLWKIDVHEQKEKVYDMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMF
ASIPNFSDFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIGSTYMAASG
VTPDSNSNGYNNTLKKEEISDKERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLN
KGAILAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQDILKEYGFRFVRRGP
IYVKGKGELLTFFLKGRDKQGSFINGSSVTLPHQVVDNS
NT seq 3360 nt   +upstreamnt  +downstreamnt
atggaaaagatgccccggaaccgagccttttccgagccggagtactctgcggaatattca
gcggactattcggtcagtttgccgtcggatgcggagcatggggtgggcaggacgcacgag
gtcaccgtacggagctctggttgttgcctctgtttgccgcgctttatgcgcctcaccttt
gctccggagtctctggaaaacctctaccagacgtacttcaggcgacagcggcacgagact
ctgctggtcctggtggtcttcgccgccctcttcgactgctacgtcatcgtcatgtgcgcc
gtggtctacagcagcgacaaactggcttctaccttggtggcagcggtggggctcttggct
cacctcttgctcttcgtcctatgcaagtttggcttgttaccggaccgcatttcccgtaag
tttgtcccctacatcctatggatcttgatagccgcccagatcttctcttacttgggcctc
aactttgcacatttccacgaggcaagtgacactgtgggttggcaggccttcttcgtcttc
tcgttcttcatcactctgccccttcgtctcacccccatcgtcctcatcaccaccgtgtcg
tgtggcattcataccctggtgttgggcgtcaccatcgctcagcagcagcaggattccatc
aatggcaatgccttgttacggcagatcttgtccaacgtggccatctacctgtgcagcatc
agcgtgggcatcatgtcttactacatggcagatcggaagcaccgcaaagcctttctggaa
gcgcgacagtctctcgaggtcaaactcaacctggaagaacaaagccagcagcaggagagg
ctccttctgtccatcctgcccaagcacattgctgacgagatgcttaacgacatgaagaag
gaccaggagcagaaagaacttcagcagttcaacaccatgtatatgtacagacatgagaat
gtcagcatactcttcgccgacattgttggatttacacaactgtcgtcgtactgcagcgcc
caagagctggtgaaactgctcaacgaactctttgcccgcttcgacaaactggcagcgaaa
aaccaccagctgcgcatcaagattttgggcgattgttactactgtatctgtgggctcccc
gactatcgggaggatcacgctgcctgctccataatgatgggacttgctatggtggacgcc
atatcttacgtgagagagaagacaaagacagatgtggacatgcgggttggagtccattca
gggacagtgattggaggggtcctggggcagaagcgctggcagtatgacgtttggtccacc
gatgtgaccttggccaacaagatggaggctggaggaattccaggaagggtccatatttcc
caaagcacctacgactgcctgaagggggagtttgaggtggaaccaggggaaggaggtaca
aggtgtgattatctgagagaaaagggcattgtgacctaccttgtagttgtaccaaagcag
ccaataaacaagaacggcatcaatggggtgaagctgtcactcacatcgtcccacgggaac
actccacagctaattaacaccaaggaatgcaacggcagcattcacaccacctgtaccacc
ccggatgagaatgaggagctggacaccagggttgtgaatccatctttccccaacccacga
agacgtctgcgcctgagagacttggccgagagggttattgacgctcagcagaacgagcag
gaactcaacaaacttctcaatgaggcactgctggagagagagaccgtgcaagtccttaaa
gggaaatacacctaccgcttgtccatgcgctttatcaacccagaaatggagaccaggttt
tctgtagagaaggagaagcagagcggagctgccttcagctgttcctgtgtcgtgttgtta
ttcacagccattgtgcagattctcatcgaccccatgcttgttgctaattacgtgaccttc
gttattggtgaaattcttcttctagttctgacgatctgttcgcttgcagccatatttccc
agggtttttccaaaaaaattagttgccttttctacatggattgatcggacaaggtgggca
cgtaacacatgggcaatgtccgccatatttattcttacaatggcagatatagtggatatg
ctcagctgcctgcagtactacagcactctcaatatgacgtcccatgaccaagaagcttgg
ggttgtgttgagaaccccaagtattacagttatattgctgtactggccctcatagccacc
atcatgctggtgcaagtcagccatatggtcaagctaactctcatgctgatgattaccatt
gccgccggcgtggtcaacatttatgcctggagaccgatcttcgatgattatgacaataag
aggttcaacggctacttggctttattggtaccttccaaatactccatgacggtcatgatt
ttcatcatgatgatcagcttctactactttgcacgacacgtggagaagttggccagaaca
ttgttcttgtggaagatcgatgtccatgaacagaaggagaaggtttatgacatgaggcgc
tggaacgaagctctggtcaccaacatgctgcctgaacatgttgctaggcacttcttggga
tccaagaaacgagatgaggagctctacagccagtcatatgacgagattggggtaatgttt
gcgtccatcccaaacttctctgatttttatacagaagaaagcatcaacaatggaggaatc
gagtgcctgaggtttcttaatgagattatctctgactttgatgcgctgttggatgaacct
cagttccgttgcatcacaaagataaagaccatcggcagcacatatatggcagcttccggg
gtgactcctgattcgaactccaatggatataacaatactttaaagaaagaagaaatctct
gacaaagagcgctggcagcaccttgcagatctggcagactttgcccttgccatgaaggtg
acactcatgaacattaactatcaatcattcaacaacttcatgctccgaataggtttaaat
aaaggcgccatacttgcgggtgtcatcggtgcacgcaagcctcattatgacatctggggg
aatacagtgaatgtcgctagtagaatggagtctacaggagtcatgggcaatatacaggtt
gtagaggaaacacaggacattctgaaggaatatggattccgttttgtaagacgaggtccc
atttacgtgaagggtaaaggcgaactgctcacgttcttcctcaaaggacgggacaagcaa
ggttccttcatcaacggttcttcagtcaccctcccgcatcaagtggtggacaactcctga

DBGET integrated database retrieval system