KEGG   Xenopus laevis (African clawed frog): 108718066
Entry
108718066         CDS       T01010                                 

Gene name
ccnb1.L, ccnb
Definition
(RefSeq) cyclin B1 L homeolog
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108718066 (ccnb1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108718066 (ccnb1.L)
   04114 Oocyte meiosis
    108718066 (ccnb1.L)
   04115 p53 signaling pathway
    108718066 (ccnb1.L)
   04218 Cellular senescence
    108718066 (ccnb1.L)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    108718066 (ccnb1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    108718066 (ccnb1.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    108718066 (ccnb1.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    108718066 (ccnb1.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    108718066 (ccnb1.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_C_2
Other DBs
NCBI-GeneID: 108718066
NCBI-ProteinID: XP_018121138
Xenbase: XB-GENE-17333722
UniProt: A0A1L8I241
LinkDB
Position
1L
AA seq 390 aa
MALIMTRSMRLNVENVASGMAGKKAAVSKPVLRPRNALGDIGNQIKSKVPLKKATKALRK
PAVQKSEKLVALEENVLKEAEVLAPHSPSPMETSLCVTEEIPPAFSSALIPVKDVDAEDS
NNPMLCSDYVKDIYCYLRNLEAQQAIRPHYLDGQEINGNMRAILVDWLVQVHLRFKLLQE
TMSMTVSILDRFLQENSVPKKLLQLAGVSAMFVACKYEEIYCPSIGDFAFVTDHTYTKSQ
IRNMEMQILRVLKFEVGRPLPLHFLRRASKIGEVDSVHHTLAKYLIELVMTDYDMVHVPP
SQLAAAAFCLAMKILNSGEWTPTLEHYMAYKESSLMPVMQQIAKNIVKVNGGHTKFLSVK
TKYTSSRQMKISCLPHLKSELVENLAKAAS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggctctgataatgaccaggagtatgcggctcaatgtggaaaatgtggcatcaggcatg
gctggaaagaaagctgcggtgtccaagcctgtattgaggcctagaaatgcactgggtgat
attggaaaccaaataaagtcaaaagttccactaaagaaggcaacaaaagctcttcggaag
cccgctgtacaaaaatctgagaaacttgttgcactagaagagaatgtacttaaggaagcg
gaggtgctagcacctcattcccctagccccatggagacctctttgtgtgtgacagaagag
atacctccagctttctccagtgccctgattccagtgaaagatgttgatgcagaagattcc
aacaacccaatgctgtgcagtgattatgtgaaagacatttactgttaccttagaaacttg
gaggctcaacaagcaatcaggccacactatctagatgggcaagagatcaatggaaacatg
agggccatattggtagactggcttgtgcaagtccatctgaggtttaaactgctgcaggag
acaatgtctatgactgtatctattctggatcgttttctgcaggaaaactctgtacccaag
aaactgttgcagctggctggagtgagtgccatgtttgttgcatgcaaatatgaagaaatc
tattgtccatcaatcggtgactttgcctttgtcacagaccacacttacacaaagtcccaa
atcagaaacatggaaatgcaaatccttagagttctcaaatttgaagttgggagacccctg
ccactgcatttcttgagaagagcatctaaaattggggaggttgactcggtacatcacaca
ctggctaaatacctaatagagctggttatgacagactatgacatggtacatgtacctcca
tcacagttggcggccgcagctttctgtctggcaatgaagattctgaatagtggagaatgg
actcctactcttgagcactacatggcatataaagaaagctcccttatgccagtcatgcag
caaatcgcaaagaatattgtaaaggtcaatggaggccatacaaagttcctgtctgtcaaa
accaaatataccagcagtcgacagatgaagattagctgcctgccacatctgaagtctgag
cttgtggaaaacctggcgaaagctgcatcatag

KEGG   Xenopus laevis (African clawed frog): 379888
Entry
379888            CDS       T01010                                 

Gene name
ccnb1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    379888 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379888 (ccnb1)
   04114 Oocyte meiosis
    379888 (ccnb1)
   04115 p53 signaling pathway
    379888 (ccnb1)
   04218 Cellular senescence
    379888 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    379888 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    379888 (ccnb1)
   03036 Chromosome and associated proteins [BR:xla03036]
    379888 (ccnb1)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    379888 (ccnb1)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    379888 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 379888
NCBI-ProteinID: NP_001080196
UniProt: Q7ZYT0
LinkDB
Position
4L
AA seq 397 aa
MSLRITRNMMANTENNVKTTLAGKRVVATKPGLRPRTALGDIGNKAELKVPAKKELKPAV
KAVKKTKPIDKVLEPLKVSEENVCPKPTPVEPSSPSPMETSGCLPDELCQAFSDVLIQVK
DVDADDDGNPMLCSEYVKDIYGYLRSLEDAQAVRPNYLHGREVTGNMRAILIDWLVQVQM
KFRLLQETMFMTVGIIDRFLQEHPVPKNQLQLVGVTAMFLAAKYEEMYPPEIGDFTFVTD
HTYTKAQIRDMEMKILRVLKFAIGRPLPLHFLRRASKIGEVTAEQHSLAKYLMELVMVDY
DMVHYAPSQIAASASRLSLKILNAGDWTPTLHHYMAYSEEDLVPVMQHMAKNIIKVNKGL
TKHLTVKNKYASSKQMKISMIPQLKSDVVVAMARPLV
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcgctgcgtatcaccagaaacatgatggcaaatacagaaaacaatgtgaaaaccact
ttggctggaaagagggttgttgccaccaaaccaggcttgagacctcgtacagcattggga
gacattggaaacaaggcagagctgaaagtgccagcaaaaaaggaattaaagccagcagta
aaggctgtcaagaagacaaaacccattgacaaagttttggagcctctgaaagtcagtgaa
gagaatgtttgccctaaacctactccggttgaacccagctcaccaagcccaatggaaaca
tctggttgcctccctgatgagctttgccaggccttctctgatgtcctgattcaagttaaa
gatgttgatgctgatgatgatggcaacccaatgctgtgcagtgaatatgtcaaagacatt
tatggctacctgagaagtcttgaggatgcacaagcagtcagaccaaattacctacatgga
cgggaagttacaggcaacatgcgtgctattttgatcgactggctggtccaggtgcaaatg
aagttccgtctgctgcaggagaccatgtttatgactgttggcattattgaccgttttctg
caggaacacccagttcccaaaaaccagctgcagcttgtgggggtcaccgcaatgttcctt
gctgctaaatacgaagagatgtacccaccagaaattggggactttacttttgtaactgat
cacacatacacaaaggctcaaattagagacatggaaatgaagatacttcgtgtgctaaag
tttgcaattggccgacctctacccctgcacttccttcggagagcatctaagattggagag
gtgactgctgagcagcatagtttggccaaatatttgatggaacttgtgatggtggattat
gacatggtgcattatgctccttcccaaatagcagcttctgcctcccgcttgtctcttaaa
atcttaaatgcaggtgactggaccccaacactgcatcactatatggcttactctgaagaa
gatctggtccctgttatgcagcatatggccaagaacataatcaaggtgaacaaaggactg
actaagcacctgactgttaagaacaaatatgccagcagcaaacaaatgaagatcagcatg
attccacaattgaaatcggatgttgttgtggcaatggcccgcccacttgtatga

KEGG   Xenopus laevis (African clawed frog): 397742
Entry
397742            CDS       T01010                                 

Gene name
ccnb1.2.S, ccnb, ccnb1, ccnb1.2
Definition
(RefSeq) cyclin B1 S homeolog
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    397742 (ccnb1.2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397742 (ccnb1.2.S)
   04114 Oocyte meiosis
    397742 (ccnb1.2.S)
   04115 p53 signaling pathway
    397742 (ccnb1.2.S)
   04218 Cellular senescence
    397742 (ccnb1.2.S)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397742 (ccnb1.2.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    397742 (ccnb1.2.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    397742 (ccnb1.2.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    397742 (ccnb1.2.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    397742 (ccnb1.2.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 397742
NCBI-ProteinID: NP_001081266
Xenbase: XB-GENE-5736929
UniProt: P13350 A0A1L8GFW9
LinkDB
Position
4S
AA seq 397 aa
MSLRVTRNMLANAENNVKTTLAGKRVVATKPGLRPRTALGDIGNKAEVKVPTKKELKPAV
KAAKKAKPVDKLLEPLKVIEENVCPKPAQVEPSSPSPMETSGCLPDELCQAFSDVLIHVK
DVDADDDGNPMLCSEYVKDIYAYLRSLEDAQAVRQNYLHGQEVTGNMRAILIDWLVQVQM
KFRLLQETMFMTVGIIDRFLQEHPVPKNQLQLVGVTAMFLAAKYEEMYPPEIGDFTFVTD
HTYTKAQIRDMEMKILRVLKFAIGRPLPLHFLRRASKIGEVTAEQHSLAKYLMELVMVDY
DMVHFTPSQIAAASSCLSLKILNAGDWTPTLHHYMAYSEEDLVPVMQHMAKNIIKVNKGL
TKHLTVKNKYASSKQMKISTIPQLRSDVVVEMARPLM
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcgctacgagtcaccagaaacatgctggcaaatgcagaaaacaatgtgaaaaccact
ttggctggaaagagggttgttgctaccaaaccagggttgagacctcgtacagccttggga
gacattggaaacaaggcagaggtgaaagtgccaacaaaaaaggaattaaagccagcagta
aaagctgccaagaaggcaaaacctgttgacaaattgttggagcctcttaaagtgatagaa
gagaatgtttgccctaaacctgctcaggttgaacccagctcaccaagcccaatggaaaca
tctggttgcctccctgatgagctctgccaggctttctctgatgtcctcattcacgttaaa
gatgttgatgctgatgatgatggcaacccaatgctgtgcagtgaatatgtcaaggacatt
tatgcttacctgaggagccttgaggatgcacaagcagtcagacaaaactaccttcatgga
caggaagtcacaggcaacatgcgtgccattttgattgactggctggtccaggtgcaaatg
aaattccgtctactgcaggagacaatgttcatgactgttggcataattgaccgctttctg
caggaacatccagttcccaaaaaccagctacagcttgtgggggtcacggctatgttcctt
gctgctaaatatgaagagatgtacccaccagaaattggagactttacatttgtaactgat
cacacatacacaaaggctcaaattcgggacatggaaatgaagatacttagggtgctaaag
tttgcaattggccgacccttacccctgcactttcttcggagagcttctaaaattggagag
gtaactgctgaacagcatagtttagccaaatatttgatggaacttgtgatggtggattat
gatatggtacatttcacgccttcccaaatagcagctgcttcctcctgcttgtctctcaaa
atcttaaatgcaggtgactggaccccaacactccatcactatatggcttactctgaagaa
gatctagtccctgttatgcagcatatggccaagaacatcatcaaggtgaacaaaggacta
accaagcatctgactgttaagaacaagtatgctagcagcaaacaaatgaagatcagcacg
attccacagctgaggtcagatgttgttgtggaaatggcccgcccactcatgtga

KEGG   Xenopus laevis (African clawed frog): 397743
Entry
397743            CDS       T01010                                 

Gene name
ccnb2.S, ccnb2, cyclinb2
Definition
(RefSeq) cyclin B2 S homeolog
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    397743 (ccnb2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397743 (ccnb2.S)
   04114 Oocyte meiosis
    397743 (ccnb2.S)
   04115 p53 signaling pathway
    397743 (ccnb2.S)
   04218 Cellular senescence
    397743 (ccnb2.S)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397743 (ccnb2.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    397743 (ccnb2.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    397743 (ccnb2.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    397743 (ccnb2.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    397743 (ccnb2.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C RFX1_trans_act
Other DBs
NCBI-GeneID: 397743
NCBI-ProteinID: NP_001081268
Xenbase: XB-GENE-1005605
UniProt: P13351 A0A1L8GT40
LinkDB
Position
3S
AA seq 392 aa
MATRRAAIPREADNILGGAMRSKVQMNSRRAALGEIGNKVTVRGKPPAVKQSSNAVAKPS
KMAATKVANVKTKHVPVKPVVAEAAPKVPSPVPMDVSLKEEELCQAFSDALTSVEDIDAD
DGGNPQLCSDYVMDIYNYLKQLEVQQSVHPCYLEGKEINERMRAILVDWLVQVHSRFQLL
QETLYMGVAIMDRFLQVQPVSRSKLQLVGVTSLLIASKYEEMYTPEVADFVYITDNAYTA
SQIREMEMIILRLLNFDLGRPLPLHFLRRASKSCSADAEQHTLAKYLMELTLIDYEMVHI
KPSEIAAAALCLSQKILGQGTWGTTQHYYTGYTEGDLQLIMKHMAKNITKVNQNLTKHVA
VRNKYASSKLMKISTLPQLMAPLITELAASLS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggctactcgtcgcgctgctattccccgtgaagcggataatatccttgggggtgcaatg
cgatccaaagttcaaatgaatagcagacgagctgctttgggagagattggcaacaaagtg
actgtgcgaggaaaaccacctgcagtaaagcagtcttccaatgctgtggcaaagccttca
aagatggcagcaactaaagtggcaaatgttaagactaagcatgtacctgtgaaaccagtt
gtagctgaagctgcccccaaagtgccttcccctgtgccgatggatgtgtccttgaaagag
gaagagctgtgccaggcattctccgatgcactgaccagtgttgaagacattgatgcagat
gatggtggaaaccctcaattgtgcagtgactatgtgatggacatctataactaccttaag
caactggaagttcaacagtctgtacatccttgctatcttgaaggaaaagaaattaatgag
cgtatgagagctatcctagttgactggcttgttcaagtgcattctaggtttcagcttctt
caggagactttatacatgggcgttgcaatcatggatcgcttcttacaagttcagccagtc
tcccgcagtaagcttcagttggttggtgttacttccctactaattgcttcaaaatatgaa
gagatgtacactccagaggttgcagactttgtttatatcaccgataatgcctatactgca
tctcagatcagagaaatggaaatgattatccttcgactcctcaactttgaccttggacgg
ccattacctctccacttcctcagacgggcttcaaaatcttgcagtgctgatgcagagcaa
catacccttgcaaaatatttgatggagcttacactcatagactatgaaatggtccacatc
aagccttcagaaattgcagctgctgccctctgcctatctcaaaaaattcttggccaggga
acctggggtaccactcagcactattacacaggctacacagaaggtgacttgcaactgatc
atgaagcatatggctaagaacataaccaaagtcaaccagaatctaacaaagcatgtggct
gtgaggaacaagtatgctagcagtaaactgatgaagatcagcacccttcctcagcttatg
gctcctctaatcacagagcttgctgcaagtctctcttag

KEGG   Xenopus laevis (African clawed frog): 398162
Entry
398162            CDS       T01010                                 

Definition
(RefSeq) cyclin B5
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    398162
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398162
   04114 Oocyte meiosis
    398162
   04115 p53 signaling pathway
    398162
   04218 Cellular senescence
    398162
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    398162
   03036 Chromosome and associated proteins [BR:xla03036]
    398162
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    398162
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    398162
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 398162
NCBI-ProteinID: NP_001081988
UniProt: Q98TI2
LinkDB
Position
3L
AA seq 390 aa
MATWAAMRTGQMDNAVVGGVVAAKVKVHGHRPPLEEISNRTAILGRKPAAMNCKVPVKVV
RQVTSRANLPLRVKQAFGPKSEEPPPIPMDVADNEEVLCQAFSEALNSVEDIDAEDSSNP
QLCADYVKDIYSYLRQLEVQQAVRPRHLQGMEINDRMRAILVDWLIQVHLKFQLLQETLY
MAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKTQIRE
MEMMILKEINFDLGRPLPLNFLRRASKCCSADAGQHTLAKYFMELTLLDYDMVHFHPSAI
AAAALCLTQKVLNMGTWDAALQFYTGYSQDDLSLPMKHMAKNIVQVNQNLSKFLSVKNKY
SSSKLLKISTIPQLNSRVLTGLAAAVTPGS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggctacttgggctgctatgcgtacaggacagatggacaatgcagtcgtgggtggagtg
gtggcagccaaagtgaaagtacatggacatagacccccactagaagaaatcagtaacagg
actgcaattctaggacgcaaacctgcagcgatgaactgcaaggtgcctgtcaaagtggtc
agacaagtaacctccagagcaaatctgcctttaagagttaaacaggcatttggccccaaa
tctgaggaacctcctcccatacctatggatgtagctgataacgaggaggtgttgtgtcaa
gctttctctgaagctttgaacagtgttgaggatattgatgcagaggattcttcaaaccct
cagttatgcgcggattatgtgaaggacatctattcctatttaaggcagttagaggttcaa
caggctgtacgcccaagacacctacagggaatggagatcaatgatcggatgagagccatt
ctagtcgactggttaatacaagtccacttaaaatttcaactacttcaagagacattatat
atggcaatagcaattatggaccgttttctacagggtcagcctatctcccgaagcaagcta
cagttggttggtgtcacctcgctcttcatagcttcaaagtatgaagaaatgtattatcca
gagatttctgactttgtttacatcactgacaacacctactccaaaactcaaattagagaa
atggaaatgatgattctcaaggagattaactttgatctaggaagaccgctgccccttaat
ttccttagaagagcttcaaaatgttgcagtgctgatgcaggacagcacacacttgccaag
tacttcatggagttgactctacttgactatgacatggttcacttccatccttcagcaatt
gctgctgctgctttgtgcctgacccaaaaggttcttaatatgggcacatgggatgctgct
ctacagttttacacaggctattcacaagatgatcttagcctgcctatgaagcatatggcc
aagaacatcgttcaggtcaaccaaaacctgtcaaaatttttatctgtgaagaataaatat
tctagtagtaaattactgaagatcagcacaatccctcaactgaactcgcgtgttttaact
ggtcttgctgctgctgtaacgccaggctcgtag

KEGG   Xenopus laevis (African clawed frog): 398163
Entry
398163            CDS       T01010                                 

Gene name
ccnb1.S, ccnb, ccnb1
Definition
(RefSeq) cyclin B1 S homeolog
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    398163 (ccnb1.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398163 (ccnb1.S)
   04114 Oocyte meiosis
    398163 (ccnb1.S)
   04115 p53 signaling pathway
    398163 (ccnb1.S)
   04218 Cellular senescence
    398163 (ccnb1.S)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398163 (ccnb1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    398163 (ccnb1.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    398163 (ccnb1.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    398163 (ccnb1.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    398163 (ccnb1.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_C_2
Other DBs
NCBI-GeneID: 398163
NCBI-ProteinID: NP_001081989
Xenbase: XB-GENE-921535
UniProt: Q6IR86
LinkDB
Position
1S
AA seq 393 aa
MALIMTRSMRLNAENVAQGMAGKKAAVSKPVPKPRNALGDIGNQIGKAKVPLKKTTKALR
KPTVQKSEKLAVLEENVPKEAQKAAPDSPSPMETSVCVIEEMQPEPAFSSALIPVTDVDA
EDSDNPMLCSDYVKDIYCYLRNLEAEQAIGPHYLDGQEINGNMRAILVDWLVQVQLRFKL
LQETMSMTVSILDRFLQENPVPKKLLQLAGVSAMFIACKYEEIYCPSIGDFVFVTDNTYT
KSQIRNMEMQILRVLNFDIGRPLPLHFLRRASKIGEVDSVHHTLAKYLIELVMTDYDMVH
IPPSQLAAAAFCLAMKILNSGEWTPTLEHYMAYKESSLTPVMQHIAKNIVKVNGGHTKFM
SVKNKYTSSRQMKISCLPHLKSELVENLAKAAS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggctctgattatgacaaggagtatgcggctcaatgcagagaatgtggcacaaggaatg
gctggaaagaaagctgctgtgtccaagcctgtaccaaagcctagaaatgcactgggtgat
attggcaaccaaatcggaaaggcaaaagttccactaaaaaagacaacaaaagctcttcgg
aaacccactgtacaaaagtctgagaaacttgctgtgctggaagaaaatgttcctaaggaa
gcgcagaaggcagcaccagattcccctagccccatggagacatcggtgtgtgtaatagaa
gagatgcaaccagaaccagctttctccagtgccctgattcctgtgacagatgtggatgca
gaagattcagacaacccaatgctgtgcagtgattatgtgaaggacatctactgttatctt
agaaacttggaggctgaacaagcaatcgggccacactatctagatgggcaagagatcaat
ggaaacatgagggccatactggtagactggcttgtgcaggttcaactgaggtttaaactg
ctgcaggagacaatgtctatgactgtatctattctggatcgttttctgcaggaaaaccct
gtacccaagaagctgttgcagctggccggtgtgagcgccatgtttattgcatgcaagtat
gaagagatctattgtccatcaattggtgactttgtctttgtcacagacaacacttacaca
aagtcccaaatcagaaacatggagatgcaaatccttagagttctcaattttgacattgga
agaccactgccgctgcatttcttgagaagagcatctaaaattggagaggttgactctgta
catcacacactggctaaatacctaatcgagctggttatgacagactatgacatggtgcac
atacctccatcacagttggcggcagcagctttctgtctggcaatgaaaattcttaatagt
ggagaatggactcctactcttgagcactacatggcatacaaagaaagttcccttacacca
gtcatgcagcacatcgcaaagaatattgtaaaagtcaatggaggacatacaaagttcatg
tctgtcaaaaacaaatacaccagcagtcgacagatgaagatcagctgtctgccacatcta
aagtctgagcttgtggaaaacctggcaaaagctgcatcatag

KEGG   Xenopus laevis (African clawed frog): 398888
Entry
398888            CDS       T01010                                 

Gene name
ccnb2.L, C-B2, cyclinb2
Definition
(RefSeq) cyclin B2 L homeolog
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    398888 (ccnb2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398888 (ccnb2.L)
   04114 Oocyte meiosis
    398888 (ccnb2.L)
   04115 p53 signaling pathway
    398888 (ccnb2.L)
   04218 Cellular senescence
    398888 (ccnb2.L)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398888 (ccnb2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    398888 (ccnb2.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    398888 (ccnb2.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    398888 (ccnb2.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    398888 (ccnb2.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 398888
NCBI-ProteinID: NP_001083368
Xenbase: XB-GENE-17330002
UniProt: Q6PA39
LinkDB
Position
3L
AA seq 392 aa
MATRRAAIPREADNILGGAMRSKVQIHGKRAALGEIGNKVTVRGKPHAVKQPSNVVAKPS
KTVATKVANVKPKPVLVKPTVAEAHTKVPSPVPMDVSMKEEELCQAFSDALTSVEDIDAD
DGGNPQLCSDYVMDIYNYLKQLEVQQSVRQCFLEGKEINERMRAILVDWLVQVHSRFQLL
QETLYMGVAIMDRFLQVQPVSRSKLQLVGVTSLLVASKYEEMYTPEVADFVYITDNAYTA
SQIREMEMIILRVLNFDLGRPLPLHFLRRASKSCSADAEQHTLAKYLMELTLVDYEMVHF
NPSEIAAAALCLSQKILGQGSWGATQHYYTGYTEGDLQLVMKHMAKNITKVNQNLTKHVA
VRNKYASSKLMKISTLPQLMAPLVTDLAASLS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggctactcgtcgggctgcaattccccgtgaagccgataatatccttgggggcgcaatg
cggtccaaagttcaaatccatggcaaaagagctgctttgggtgaaattggcaacaaagtg
accgtgcgaggaaaaccacatgcagtcaagcagccttccaatgttgtggcaaagccgtca
aagactgtggcaactaaagttgcaaatgttaagccaaagcctgtacttgtgaaaccaaca
gtagctgaagctcacaccaaagtgccttcccctgtgccaatggatgtgtctatgaaagag
gaagagctgtgccaggcattctctgatgctttgaccagtgttgaagacattgatgcagat
gatggtggcaaccctcaattgtgcagtgactatgtgatggacatctataactacctaaag
caactggaagtccaacagtctgtacgccaatgctttctggaaggaaaagagattaatgag
cgtatgagggctatcctagttgactggcttgttcaagtgcattctaggtttcagcttctt
caggagactttgtacatgggtgttgccatcatggatcgcttcttgcaagttcagccagtc
tcccgcagcaagcttcagttggttggtgttacttccctactagttgcttccaaatatgaa
gagatgtacaccccagaggttgcagactttgtttatatcaccgataatgcctacactgca
tctcagatcagagaaatggaaatgattatccttagagtcctcaactttgaccttggacgt
ccattacctctccacttcctgagacgggcttcaaaatcttgcagtgctgatgcagagcaa
catactcttgcaaaatatctgatggagcttacactcgtagactatgaaatggtacacttc
aatccttcagaaattgcagctgctgcactctgcttatcccaaaaaattcttggccaggga
agctggggtgctactcaacactattacacaggctacacagaaggggacttgcaactggtc
atgaagcatatggccaagaacataaccaaagtcaatcagaatctaactaagcatgtggct
gtgcgaaacaagtatgcaagcagtaaactgatgaagatcagcacccttcctcagctgatg
gctcctcttgtcacagaccttgctgcaagtctctcttag

DBGET integrated database retrieval system