KEGG   Xenopus laevis (African clawed frog): 108718092
Entry
108718092         CDS       T01010                                 

Gene name
zmat3.S, pag608, wig-1, wig1
Definition
(RefSeq) zinc finger, matrin-type 3 S homeolog
  KO
K10137  zinc finger, matrin type 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108718092 (zmat3.S)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 108718092
NCBI-ProteinID: XP_018121182
Xenbase: XB-GENE-17332517
UniProt: A0A1L8G463
LinkDB
Position
5S
AA seq 291 aa
MIVLQHASPPPHPECSACPSTLGIGERQIMIPTAIQSQRSPVNTSHLTSLEVTQDEEFAK
FLEQDPSLEDLCKHLSCKLCNVTLNSAQQAQAHYQGKNHNKKLRNYSASSSCPASSRMSH
TLEITSPPAVSSLNTSSTKAGGRVILATKNDYCKLCDASFSSPVVAQAHYQGKNHAKRLR
LAETPANCFMDSTECKRKTRKDGNEHKVMPMRKNSCTVQNSTGPYFNPRSRQRIPRDLAM
CVTPSGQFYCSMCNAGASEELEFRQHLETKQHKSKVSEQRYRSEMENLGYM
NT seq 876 nt   +upstreamnt  +downstreamnt
atgattgtgctgcaacatgccagccctccaccgcatccagagtgctctgcttgtccttcc
accttgggaataggcgaaaggcaaatcatgatccctactgccattcagtctcagaggagt
cctgttaatacttcccatttgacctccttagaagttactcaggatgaagaatttgcaaag
tttttggaacaagatccctcactggaagatctttgtaagcatctgtcctgcaagctgtgt
aacgttactctgaactcagcacagcaggctcaagctcactatcagggcaaaaatcacaac
aagaagcttcgcaattacagtgcatcgagtagctgtcctgcatcatcaagaatgagtcac
actctggagataacttcgcccccagctgtatcatcactgaatacttcctcgacaaaagca
ggtgggcgtgtgattcttgccactaagaatgactactgcaaactgtgtgatgcctctttc
agctccccagttgtagcccaagctcactatcaaggaaagaaccatgcaaaaagattacgc
ctagcagaaacacctgcaaactgttttatggattcaactgaatgtaagagaaaaactcga
aaagatggaaatgagcataaggtgatgccaatgagaaaaaattcctgcacagttcagaac
agtacaggtccatatttcaatcctcgttctcgacagagaattcccagagacctagccatg
tgtgtcactcccagtggccaattttactgttcaatgtgcaacgcaggagccagtgaagaa
ctggagtttcggcagcacctagagacaaagcagcacaaaagcaaagtttctgagcagcga
taccgcagtgaaatggaaaacttgggatacatgtag

KEGG   Xenopus laevis (African clawed frog): 734854
Entry
734854            CDS       T01010                                 

Gene name
zmat3.L, pag608, wig-1, wig1, zmat3
Definition
(RefSeq) zinc finger, matrin-type 3 L homeolog
  KO
K10137  zinc finger, matrin type 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    734854 (zmat3.L)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1 HemS
Other DBs
NCBI-GeneID: 734854
NCBI-ProteinID: NP_001089789
Xenbase: XB-GENE-1014349
UniProt: Q3KPT4
LinkDB
Position
5L
AA seq 262 aa
MIPIAIQSQRSPVNASHSASLEVTQDEELAKVLEQDPSLEDLCKPLSCKLCNVTLNSAQQ
AQAHYQGKNHNKKLRNYCASSSCPASSRMSQTVEMISPQAVSSLNTSSTKACGRVILATE
NDYCKLCDASFSSPVVAQAHYQGKNHAKRLRLAETPANCFMDSTECKRKTRKEGNEHKVM
AMRRNACAVQNNTGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNAGASEELEFRQHLET
KQHKSKVSEQRYRSEMENLGYM
NT seq 789 nt   +upstreamnt  +downstreamnt
atgatccctattgccattcagtctcagaggagtcctgttaatgcttcccattcagcttcc
ttagaagttacccaggatgaagaactcgcaaaggtcttggaacaagatccctcgttggaa
gatctttgtaagcctctgtcttgtaagctgtgtaatgtcactctaaactctgcacagcag
gctcaagctcactatcagggcaaaaatcataacaagaagcttcgcaattactgtgcatcg
agtagctgtcctgcatcatcaagaatgagtcaaaccgtggagatgatttcgccccaagcc
gtatcgtcattgaatacatcctccacaaaagcatgtgggcgtgtaattcttgccactgag
aatgattactgcaaattgtgtgatgcttctttcagctccccagttgtagcccaagctcac
taccaaggaaagaaccatgcaaaaagattacgcctagccgaaacgcctgcaaactgtttt
atggattcaactgaatgtaagagaaaaactcgaaaggaagggaatgagcataaggtgatg
gcaatgcgaagaaatgcctgcgcggttcagaacaatacaggtccatatttcaatcctcgt
tctcgacagagaattcccagagacctagccatgtgtgtcactcccagtgggcagttttac
tgttcaatgtgcaacgcaggagccagtgaagaactggagtttcggcaacacctagagaca
aagcagcacaaaagcaaagtctctgagcagcgataccgcagtgaaatggagaacttgggt
tacatgtag

DBGET integrated database retrieval system