KEGG   Xenopus laevis (African clawed frog): 108718324Help
Entry
108718324         CDS       T01010                                 

Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00270  Cysteine and methionine metabolism
xla01100  Metabolic pathways
Module
xla_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    108718324
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    108718324
   03036 Chromosome and associated proteins [BR:xla03036]
    108718324
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     108718324
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    108718324
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108718324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 108718324
NCBI-ProteinID: XP_018121552
LinkDB All DBs
Position
5S
AA seq 937 aa AA seqDB search
MMPSNGPVLNTSNSPTETQALKGDAAVEENKSKEEKSDKGVSSKKSGRPGRKRKHSMVES
ANVSKDIASVPKCHMSPDTTHPDPIHNGDMDSANRQHKPERSSQDRPTPELSLRDMKTCG
SPELLRDSEVNLVVENGCCTPSDEMDPQQMEDCDVSVICATKKRGRRRLSNSSEKSKEEK
EDTSSDSPKSEGYRSRLRGGLSWETSLRQRPMQRLPFQAGDPYYISKRKRDEWLARWKLE
AEKKQQLVAVINAMEETVSLEPQKEEEPSLPASQQPTDPASPTVATTPEPVAPDAVDKNT
SKSADNEAEYEDGRGFGIGDLVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDS
KFSVVCVEKLLPLSSFAGTYHQPTYSKQPMYRKAIYEVLQVASTRARKVFPSCPENDESD
NSKAVEIQNKQMIEWALGGFQPSGPKGLDPPEEERNPYKEVYTEMWVEPEAAAYTPPPPT
KKPRKSTEKPKVKEIIDEGTRERLVYEVRQKCRNIEDICISCGSLNVNLEHPLFTGGMCQ
NCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAA
IKEDPWNCYMCGHKDICGLLKRRDDWPSRLQIFFANNHDQEFEPPKLYPPIPAEKRKPIR
VLSLFDGIATGLLVLKDLGIHIERYIASEVCEDSITVGMVRHQGKIMYVGDVRNITRKHI
QEWGPFDLVIGGSPCNDLSIVNPARKGLFEGTGRLFFEFYRLLHEARPKEGDKRPFFWLF
ENVVAMGVSDKRDISRFLESNPVMIDAREVTAAHRARYFWGNLPGMNRPLVSTVNDKLEL
QDCLEHGRLAKFGKVRTITTRSNSIKQGKDQHFPVHMNEKEDILWCTEMERVFGFPVHYT
DVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEFYACV
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtctaatggccccgtcctcaacaccagcaactccccgacagagacacaagcg
ctcaagggagatgcagccgtggaagaaaataagagcaaagaggaaaagtcagacaagggg
gtgtcctcaaagaaatcggggcgtccagggagaaagcgcaagcacagcatggtggaaagc
gctaatgtatccaaagacattgcctcagttcctaagtgccacatgtctccagacaccaca
cacccagatccaattcacaatggagatatggattccgccaacaggcagcacaagccagag
aggtccagccaagatcgaccaacaccagagctaagtctaagagacatgaagacctgtggt
tcaccagaactgctaagagacagtgaggtaaacctggtggtggagaatggatgttgcact
ccaagcgatgagatggatcctcagcaaatggaggactgtgatgtttcagtgatctgcgca
accaagaaaagagggagaagaaggctgtccaacagctcagagaaaagcaaagaagagaag
gaagatacaagctccgactctcccaaatcagagggataccgaagccggctgcgtggagga
ttaagctgggagactagtctacgtcagaggccaatgcaaagactacccttccaggctggg
gacccctattacatcagcaagaggaagcgagatgagtggttggccagatggaaactggag
gctgagaagaagcagcagttggtagccgtgatcaacgccatggaagaaacggtgtcactg
gaacctcagaaggaagaggaacccagtctgccggcctcccagcaacccacagaccccgcc
tcccccactgtggccaccacccccgaaccagttgcacctgatgctgtcgacaaaaatacg
tccaagtctgcagacaacgaggcagaatatgaggatggtcggggctttggcattggagat
ctggtgtggggcaagctccgtggcttctcctggtggcccggtcgcattgtatcttggtgg
atgacgggaaggagccgcgcagcagaggggacacgttgggtcatgtggtttggggacagc
aagttctctgtggtttgtgtggagaaactgttgcctctcagttcattcgccggtacctac
caccagcccacctacagcaagcagcccatgtaccgcaaagccatctatgaggttctccag
gtggccagcacccgagccagaaaggttttcccatcatgcccagagaacgacgagtcggac
aattccaaagcagtagaaatccagaacaagcagatgatcgagtgggcgctgggtggcttc
caaccctctggccccaaaggcctggatcctccagaagaggagcgcaacccatacaaagaa
gtttacacagaaatgtgggtggaacctgaagcagctgcctacactcctccccctccaaca
aaaaaacctcgaaaaagcacagaaaaacccaaggtcaaggaaatcattgatgagggcaca
cgagagagactggtctatgaagtgaggcagaagtgcaggaacattgaagatatctgtatt
tcttgcggcagtttgaatgttaacctggaacaccccctgtttacgggtggcatgtgccaa
aactgcaagaactgcttcctggagtgcgcttaccaatacgatgacgacggctatcaatcc
tactgcaccatatgctgcggagggagggaggtgctaatgtgcggcaataataactgctgc
aggtgcttttgtgtcgagtgtgtggacttgcttgtgggaccaggtgcagcccaggcagct
attaaagaagatccttggaactgctacatgtgcggacacaaggacatctgcgggctactg
aagaggcgcgatgactggccctcccggctgcagattttctttgccaacaaccacgaccaa
gaatttgaaccaccaaagctttatccgcctataccagctgaaaagcggaagcctatccga
gtactgtctctgtttgatggcattgcaacaggtctattggtgctaaaggatcttgggatc
cacatagaacgttacattgcctcagaggtgtgtgaagactccatcactgtcggtatggtg
cgacatcagggaaagatcatgtacgtgggagatgtgcgcaatatcacccgtaagcatatt
caggaatggggcccttttgaccttgttattgggggaagtccttgtaacgatctttccatc
gtgaacccagcacggaaaggtctgtttgaaggcaccgggagactcttttttgagttctat
cgtttacttcacgaggccaggcctaaggaaggagacaaacggccgttcttctggctcttt
gagaatgtggtggccatgggcgttagtgacaaaagggacatctcacgtttcctagagtca
aacccagtgatgatcgatgcaagggaggtgacggcagcccacagagctcgttacttctgg
ggtaaccttcccggtatgaacaggcctctggtttctacagtaaatgataagctggaatta
caagactgtttggaacatggcaggttagcaaagtttggcaaggtccgcaccatcaccact
aggtcgaactccatcaagcagggcaaggaccagcatttccccgtgcacatgaatgagaag
gaggacattctctggtgcactgagatggaaagggttttcggcttcccagtccactacact
gacgtttccaatatgagtcgtttggcaaggcaaaggcttctgggaagatcctggagtgtc
ccggtcattcgtcacctctttgcccctcttaaggaattttatgcctgtgtttaa

DBGET integrated database retrieval system