KEGG   Xenopus laevis (African clawed frog): 108718725
Entry
108718725         CDS       T01010                                 

Gene name
serpinb5.L
Definition
(RefSeq) serpin peptidase inhibitor, clade B (ovalbumin), member 5 L homeolog
  KO
K10139  serpin B5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    108718725 (serpinb5.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    108718725 (serpinb5.L)
Peptidases and inhibitors [BR:xla01002]
 Peptidase inhibitors
  Family I4: serpin family
   108718725 (serpinb5.L)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 108718725
NCBI-ProteinID: XP_018122601
Xenbase: XB-GENE-17337374
UniProt: A0A1L8FXR7
LinkDB
Position
6L
AA seq 379 aa
MDALRLANTGLAVDIFKKLCEKSSTDNFVFSPLCISTSLALLHKGSQGGTASELEKALHF
EKVKDSDFGFQLLSSDISKISSVYSFKLLKRVYVDNSIECKKDFINSTKKPYPSELETID
IKSRPEEARSQINSSVKELTDGNFESVLKEGSCDEKTNIIMLGAASFKGNWVYKFNESDT
KEMDFHINKKETKPVQMMHLEARLSIGYINELKTMVLELPFTSKHISILILLPKDIEDDS
TGLKKLEQDMTFEKYTHWTNPSMMANSKVKVYLPKFKLESSYDLKDMLKSLGINNAFNEE
TCDFSGMTESKGISISQAIHKACIEVNEDGTETADVTMERRLMNKEEFLVNHPFIFILRH
NKTRTIIMLGRYCGPSTDD
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggatgcgctacgtctagcaaatactggcttggcagtagatatttttaaaaaattgtgt
gagaagagctcaacagataattttgtcttctcaccactatgcatctccacctctctggct
ttactgcacaagggatcacaaggaggcacagcaagtgaactagagaaagcccttcatttt
gaaaaagtgaaagattccgattttggatttcagttactctcttccgatatctccaaaata
agctccgtatactcatttaaactattgaaacgtgtctacgtggacaacagcattgagtgc
aaaaaggattttatcaattcaaccaagaaaccatacccatccgaactggaaactattgat
atcaagagtcgacctgaagaggcaagaagtcaaataaattcctcagtaaaagagctaact
gatggtaactttgagtctgtcttgaaagagggttcatgtgatgagaagacaaatatcatt
atgcttggtgcagccagtttcaagggaaattgggtttataaatttaatgaatctgataca
aaagaaatggattttcatataaataagaaagaaacaaagcctgtgcagatgatgcattta
gaagcccgtctaagcattggatatataaatgagctgaaaacaatggtattagagctaccg
tttaccagcaagcacataagcattctcatcttgttacctaaagatattgaggatgattcc
actggtctaaaaaagctggaacaggacatgacttttgaaaagtatactcattggaccaat
ccaagcatgatggctaacagcaaggtgaaagtgtatttgcccaaattcaagctggaaagc
tcatatgaccttaaggatatgctgaaaagtttgggaataaacaacgcatttaacgaagag
acatgtgacttttctggaatgacggagagtaaaggcatatctatctctcaagctatacat
aaggcctgcattgaggtgaatgaagatggcactgagacagcagatgtgaccatggagagg
cgactaatgaataaagaggagttccttgtaaaccacccgtttatatttattctaaggcac
aataaaacacgcacaatcattatgttaggcagatattgtggcccttcaactgatgattaa

KEGG   Xenopus laevis (African clawed frog): 444699
Entry
444699            CDS       T01010                                 

Gene name
serpinb5.S, serpinb5
Definition
(RefSeq) serpin peptidase inhibitor, clade B (ovalbumin), member 5 S homeolog
  KO
K10139  serpin B5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    444699 (serpinb5.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    444699 (serpinb5.S)
Peptidases and inhibitors [BR:xla01002]
 Peptidase inhibitors
  Family I4: serpin family
   444699 (serpinb5.S)
SSDB
Motif
Pfam: Serpin Effector_1
Other DBs
NCBI-GeneID: 444699
NCBI-ProteinID: NP_001086270
Xenbase: XB-GENE-5803019
UniProt: Q6GLQ1 A0A1L8FS92
LinkDB
Position
6S
AA seq 383 aa
MDALRLANTGLAVDIFKKLCEKSATDNFVFSPICISTSLALLHRGSQGNTASELQKVLHF
EKVKDSDFGFQLLSSDISKVISIYSLKLLKRVYVDNSIECKKDFINSTKKPYPLELETID
IKSRPEEARCQINSSVKELTDGNFEAVLNEGSCDEKTKIIMLGAASFKGNWVYKFNESET
KEMDFHINKKETKPVQMMHLEARLSIGYINELKTMVLELPFTSKHLSILILLPKDIEDDS
TGLKKLEQDMTFEKYAQWTNPSMMANSKVKVYLPKFKLESSFDLKDMLKSLGINDAFNEE
ASDFSGMTESKDTSISQAIHKACIEVNEDGTEAPDVTMERRLMNKEEFCADRPFIFILRH
NKTRTIIMFGRYCGPCEASSTAD
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatgcgctacgtctagcaaatactggcttggcagtagatattttcaaaaaactgtgt
gagaagagcgcaacagataattttgtcttctcaccaatatgcatctccacctctctggct
ttactgcacaggggatcacaaggaaacacagcaagtgaactacagaaagttcttcacttt
gaaaaagtgaaagattcagattttggatttcagttactctcttcagatatctccaaagta
atctcaatatactcattaaagctattgaagcgtgtctacgtggataacagcattgaatgc
aaaaaggattttatcaattcaaccaagaaaccatacccattggaactggaaactattgat
attaagagtcgacctgaagaggcaagatgtcaaatcaattcctcagtaaaagagctaact
gatggaaactttgaggctgtcttgaatgagggttcatgtgatgagaaaacaaaaatcatt
atgcttggtgcagccagtttcaagggaaattgggtttataaatttaatgaatctgaaaca
aaagaaatggattttcatataaataagaaagaaactaagcctgtgcagatgatgcatcta
gaagctcgtctaagcattggatatataaatgagctgaaaacaatggtattagagctgccc
tttaccagcaagcacctaagcattctcatcttgttacctaaagatattgaagatgattca
actggtctaaaaaagctcgaacaggacatgacttttgaaaagtacgctcaatggaccaat
ccaagcatgatggctaacagcaaagtaaaagtgtatttgcccaaattcaagctggaaagc
tcatttgatcttaaggatatgctgaaaagcttgggaatcaatgacgcatttaacgaagaa
gcatctgacttctccgggatgacggagagtaaagacacatctatctctcaagcgatacat
aaagcctgcattgaagtgaatgaagatggcactgaggcaccagatgtgaccatggagagg
cgtttaatgaataaagaggaattctgtgcagaccgcccatttatatttattttaaggcac
aataaaacacgcactatcattatgtttggcagatattgtggcccttgtgaggcatcttca
actgctgattaa

DBGET integrated database retrieval system