KEGG   Xenopus laevis (African clawed frog): 108718882
Entry
108718882         CDS       T01010                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108718882
   04115 p53 signaling pathway
    108718882
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108718882
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108718882
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 108718882
NCBI-ProteinID: XP_018122880
UniProt: A0A1L8FW52
LinkDB
Position
6L
AA seq 105 aa
MGDAEKGKKVFVQKCSQCHTVEKSGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DENTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgctgagaaaggcaagaaagtctttgtccagaaatgttcccagtgccacact
gtagaaaaatcaggcaagcacaaaactggacccaaccttcacggcctgtttggacgcaag
actggtcaagcagaaggcttttcctatactgatgctaacaaaaataagggaattgtttgg
gatgagaatacccttctggaatatctggaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttaatagcatatctcaaa
caatcaacatcctcttaa

KEGG   Xenopus laevis (African clawed frog): 414705
Entry
414705            CDS       T01010                                 

Gene name
cyct.S, cycs-b, cyct, cyct-a, cyct-b
Definition
(RefSeq) cytochrome c, testis S homeolog
  KO
K08738  cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    414705 (cyct.S)
   04115 p53 signaling pathway
    414705 (cyct.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    414705 (cyct.S)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    414705 (cyct.S)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 414705
NCBI-ProteinID: XP_018091418
Xenbase: XB-GENE-6252130
UniProt: Q6NTN0 A0A1L8EWA6
LinkDB
Position
9_10L
AA seq 105 aa
MGDAGKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEETLLEYLENPKKYIPGTKMIFAGIKKKNERLDLIAYLKKSTSE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggggacgctggaaagggaaagaagatctttatccagaagtgcgcacagtgccacaca
gttgaaaagaccggaaaacacaagactgggccaaacttatggggtctcttcggccgtaaa
actggacaagccccaggattttcttacaccgatgcgaacaaaagcaaaggcattgtatgg
ggagaagaaaccctgttagaatatttggaaaacccaaagaaatatattccaggaaccaag
atgatttttgctggcattaaaaagaagaatgagcgcttagatctgattgcctatttaaaa
aagtccacatcagagtga

KEGG   Xenopus laevis (African clawed frog): 443888
Entry
443888            CDS       T01010                                 

Gene name
cyct.L, cycs-a, cyct, cyct-a, cyct-b
Definition
(RefSeq) cytochrome c, testis L homeolog
  KO
K08738  cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    443888 (cyct.L)
   04115 p53 signaling pathway
    443888 (cyct.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    443888 (cyct.L)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    443888 (cyct.L)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 443888
NCBI-ProteinID: NP_001085462
Xenbase: XB-GENE-6251722
UniProt: Q6GQE4 A0A1L8EP78
LinkDB
Position
9_10S
AA seq 105 aa
MGDAEKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERLDLIAYLKKSTSE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggggatgctgaaaagggaaagaagatctttatccagaagtgtgctcagtgccacaca
gttgaaaagactgggaaacacaagactgggcctaacttatggggtctcttcggccggaaa
actggacaagccccgggattttcttacactgatgcaaacaaaagcaaaggcattgtctgg
ggagaggatacgctgtttgaatatttggaaaacccaaagaaatatattccaggaaccaaa
atgatttttgctggcataaaaaagaagaacgagcgcttagatttgattgcctacttaaag
aagtccacatcagagtga

KEGG   Xenopus laevis (African clawed frog): 444530
Entry
444530            CDS       T01010                                 

Gene name
cycs.S, cycs, cyct
Definition
(RefSeq) cytochrome c, somatic S homeolog
  KO
K08738  cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    444530 (cycs.S)
   04115 p53 signaling pathway
    444530 (cycs.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    444530 (cycs.S)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    444530 (cycs.S)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 444530
NCBI-ProteinID: NP_001086101
Xenbase: XB-GENE-971594
UniProt: Q6DKE1 A0A1L8FR74
LinkDB
Position
6S
AA seq 105 aa
MGDVEKGKKVFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgttgagaaaggcaagaaagtctttgtccagaaatgttcccagtgccacact
gtagaaaaaggaggcaagcacaaaactggacctaaccttcatggcctgtttggacgcaag
actggtcaagcagaaggcttttcttatactgatgctaacaaaaataagggaattgtttgg
gatgaggatacccttatggtatatctagaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttgatagcatatctcaaa
cagtcaacctccagttaa

DBGET integrated database retrieval system