KEGG   Xenopus laevis (African clawed frog): 108719029
Entry
108719029         CDS       T01010                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04144  Endocytosis
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108719029
   04350 TGF-beta signaling pathway
    108719029
   04371 Apelin signaling pathway
    108719029
   04068 FoxO signaling pathway
    108719029
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108719029
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108719029
  09143 Cell growth and death
   04218 Cellular senescence
    108719029
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108719029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108719029
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108719029
Protein kinases [BR:xla01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108719029
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 APH
Other DBs
NCBI-GeneID: 108719029
NCBI-ProteinID: XP_018123105
LinkDB
Position
6L
AA seq 500 aa
MSVSASWPWLPRLFVLLLVALICGTEALKCHCEHCAKENYTCITDGLCLVSISVEDGKET
HNSMCYANTELVPRDRPFVCAPSTNIGTYHDVRCCYTDFCNKKLPSPTLPPLRSTANFGP
VELAAVIAGPVCLVCILLMLILYICHNRTVIHHRVPNDEDPSLDRPFISEGTTLKDLIYD
MTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWF
REAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVSVEGML
KLSLSTASGLAHLKFXMYLLIGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATD
TIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHED
YQLPYYDLVPSDPSVEEMKKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARL
TALRIKKTLSQLSQQEGLKM
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtctgtatcggcttcttggccgtggctgccaaggctcttcgttctcttgttggttgcg
ctgatttgtgggactgaggccctaaaatgtcattgcgagcactgtgcgaaagaaaactat
acctgcataaccgatggactgtgcttagtttctatctcagttgaagatggcaaagaaacc
cacaacagcatgtgctatgctaacacggaacttgtacctcgagacagaccttttgtgtgt
gcaccttccactaatattggaacataccatgatgttcgttgttgttatacagacttctgc
aataagaaactaccatctccaactttaccaccacttaggtctactgcaaacttcgggcct
gtggagttggcagctgttatagctggtccagtttgccttgtttgcatcctactgatgttg
atcctttatatttgccataaccggacagtcattcatcatagagttcctaatgatgaagat
ccttcattagatcgtccttttatatctgaaggcacaacactaaaagatcttatttatgat
atgacaacttcaggatctggctcaggtctacctttacttgtgcaaagaacaattgcgaga
acaattgttttgcaagaaagcattggaaagggtcgatttggtgaagtgtggcgtggaaag
tggaggggagaggaagtggcagtgaaaattttttcttcaagggaagagcgttcctggttc
cgtgaagcagaaatatatcagacagtcatgctgcgccatgaaaacatacttggtttcatt
gcagcagacaacaaagataatggcacatggactcagctttggttggtttcggattaccat
gaacatggatcactgtttgattacctaaatcggtatacagtgagtgtagaaggaatgttg
aagctttctttatccactgctagtggtttagctcatctgaaattttgaatgtatctttta
ataggtaaaccagcaattgcccaccgagatttgaagtccaaaaatatattggttaagaaa
aatggaacttgctgtattgctgacctgggcctggctgtcaggcatgattctgctacagat
acaatagatattgcaccaaatcacagagttggaacaaaaagatatatggcaccagaggtt
ctggatgactctattaatatgaaacattttgaatcatttaagcgtgctgatatctatgcg
atgggcctagttttctgggaaatagcacggcgatgttccataggtggaattcatgaagat
tatcagttaccttattatgaccttgtaccttctgacccatctgttgaagaaatgaaaaaa
gtggtttgcgaacagaaattaagaccaaacattccaaacaggtggcaaagctgtgaagca
ctgcgtgtgatggccaaaataatgcgtgaatgttggtatgccaatggagcagcacggcta
acagctttacgaatcaagaaaactttgtcacaactaagccaacaggaaggcctaaaaatg
taa

KEGG   Xenopus laevis (African clawed frog): 399295
Entry
399295            CDS       T01010                                 

Gene name
tgfbr1.S, TrR-1, aat5, acvrlk4, alk-5, alk5, lds1a, lds2a, skr4, tgfbr1, tgfr-1, x-trr1, xTrR-1
Definition
(RefSeq) transforming growth factor beta receptor I S homeolog
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04144  Endocytosis
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    399295 (tgfbr1.S)
   04350 TGF-beta signaling pathway
    399295 (tgfbr1.S)
   04371 Apelin signaling pathway
    399295 (tgfbr1.S)
   04068 FoxO signaling pathway
    399295 (tgfbr1.S)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    399295 (tgfbr1.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    399295 (tgfbr1.S)
  09143 Cell growth and death
   04218 Cellular senescence
    399295 (tgfbr1.S)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    399295 (tgfbr1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    399295 (tgfbr1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     399295 (tgfbr1.S)
Protein kinases [BR:xla01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   399295 (tgfbr1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 399295
NCBI-ProteinID: NP_001084084
Xenbase: XB-GENE-865194
UniProt: Q91595
LinkDB
Position
6S
AA seq 500 aa
MSVSASYLRLPRLFVLLLVALIRWSEALKCHCETCVKENHTCITDGMCLVSIFVKDGIET
HNSECVANSKLVPVDRPIMCEPFPSTAIYIKVDCCETDFCNKKLPSPTSPPTRTTQGLGP
VELAAIIAGPVCLVCILLMLTLYICHNRTVLHHRVPNEEDPSLDRPFISEGTTLKNLIYD
MTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWF
REAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVNVEGML
KLSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATD
TIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCFVGGIHED
YQLPYYDLVPSDPSVEEMKKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARL
TALRIKKTLSQLSQQEGLKM
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtctgtatcggcttcttatctgagactgccaaggctcttcgtgcttttgttggttgca
ctgatacgttggtccgaggccctaaaatgtcattgcgagacctgtgtgaaggaaaaccat
acctgcataaccgatggaatgtgcttagtttctattttcgtcaaagatggcatagaaacc
cacaacagcgaatgcgttgctaactctaaacttgtacctgtagacagaccaattatgtgc
gaacctttccctagtactgcaatatacattaaagtggactgctgtgaaactgacttctgc
aataagaaactaccatctccaacttcaccaccaactaggacaacccaaggcttggggcct
gtggagttagcagctattatagctggcccagtttgccttgtttgcattctactgatgttg
accctttatatttgtcataaccgcacagtccttcatcatagagttcctaatgaggaagat
ccttcgttagatcgaccttttatatctgagggcacaacattaaaaaatcttatttatgat
atgacaacttcaggatctggctcaggtctacctttacttgtgcaaagaacaattgcaaga
acaattgttttacaagaaagcattggaaagggtcgatttggtgaagtgtggcgtggaaag
tggaggggagaggaagtagcagtaaaaatattttcttcaagagaagagcgttcctggttc
cgtgaggcagaaatatatcaaacagtcatgttgcgccatgagaacatccttggtttcatt
gcagcagacaataaagataatggcacatggactcagctttggttggtttctgattatcat
gaacatggatcactatttgattacctaaatcggtatacagtgaacgtagaaggaatgttg
aagctttctttatccactgctagtggtttagctcatcttcatatggagatagttggaaca
caaggtaaaccagcaattgcccaccgagatttaaagtccaaaaatatactggttaagaaa
aatggaacttgctgtattgctgacctgggcctggctgtcaggcatgattctgctacagat
acaatagatattgcaccaaatcacagagttggaacaaaaagatatatggcaccagaagtt
ctggatgactctattaatatgaaacattttgaatcatttaagcgtgctgatatctatgca
atgggcctggttttctgggaaatcgcacggcgatgttttgtaggaggaatccatgaagat
tatcagttaccttattatgaccttgtaccttctgacccatctgttgaagaaatgaaaaaa
gtggtttgcgaacagaaattaagaccgaacattccaaacagatggcaaagttgtgaagca
ctgcgtgtgatggccaaaataatgcgtgaatgttggtatgccaatggagcagcacgtcta
acagctttacgaatcaagaaaactttgtcacaactaagccaacaggaaggccttaaaatg
taa

DBGET integrated database retrieval system