KEGG   Xenopus laevis (African clawed frog): 108719963
Entry
108719963         CDS       T01010                                 

Gene name
tgfbr2.S, aat3, faa3, lds1b, lds2b, mfs2, riic, taad2, tgfbeta-rii, tgfr-2
Definition
(RefSeq) transforming growth factor beta receptor II S homeolog
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04144  Endocytosis
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108719963 (tgfbr2.S)
   04350 TGF-beta signaling pathway
    108719963 (tgfbr2.S)
   04068 FoxO signaling pathway
    108719963 (tgfbr2.S)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108719963 (tgfbr2.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108719963 (tgfbr2.S)
  09143 Cell growth and death
   04218 Cellular senescence
    108719963 (tgfbr2.S)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108719963 (tgfbr2.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108719963 (tgfbr2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108719963 (tgfbr2.S)
Protein kinases [BR:xla01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108719963 (tgfbr2.S)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 108719963
NCBI-ProteinID: XP_018124786
Xenbase: XB-GENE-17340965
LinkDB
Position
6S
AA seq 809 aa
MGPGCYNSAMGLGGCLWLLIGFWSLTGSSVSINFPIDQDSFRLCKFCDKMPTNCSDRGRC
RINCDVTTFCDPEDACVAIWRMKNQNATIETMCHSLTKDLFGHKLEIHSGKKCVMQRKKS
PGETLYICACLEEECNEELFFKDDKDTNMNDTDQRALPRSPNDGKYPVKSGVYKNAPVLC
KSCEMRTTACEKEGWCNSSCETTKKCEYGDVCVAIWRNNNNIFTEESLCHNPSQTLHGHT
LDDHGSSNCIMKSKETNGEALFMCSCNANECNSKFFRGPNTKTPTKWKLNAVCMFCDVLE
TTCEKKDNCTSVCIKNSICANKGEICVAIWRNIGGNITEETICHDPKNELYGYYLDDYLS
KECIMKEKKTSEGIMFMCSCDEDMCNERYIFSKEKDIILDADPSKDILLKVLLITLLPLV
WITIAVIVTFYCYRVQRTKKLKKKWDKNPKCMRHPDMDCSDACAIMIDDDRSDISSTCAN
NLNHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQYETVAVKIFHFEEYASWKMEKDI
FSDINLKHENVLQFLTAEERKTDIGKQFWLITAFHAKGNLQEYLTKHIISWEDLLKLGGS
LARGVAHLHSDHTPCGRPKTPIVHRDVKSSNILVKNDVTCCLCDFGLSLWLEPSLSVDDL
ANSGQVGTARYMAPEVLESRINLDNIESFKQTDVYSMALVLWEITSRCNANGDVKDYEPP
FGSKVREHPCIESMKDNVLRDRGRPEISNSWLSHQGIQLVCETITECWDQDPEARLTAQC
VDERFKEMQNLDSLSERSCSEEKIPEDCS
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgggacctggatgttataacagcgctatgggtctgggcggctgcttgtggctcctcata
gggttttggagtttgacaggcagctcggtttcaatcaactttcctatagaccaggattct
tttcgtttgtgcaagttttgtgataagatgccgacgaactgcagtgatagaggccgatgc
aggatcaactgtgatgtgaccactttttgtgatccagaagatgcttgtgtagcaatatgg
aggatgaaaaaccagaatgcaactatagaaactatgtgccacagccttacaaaggatctc
tttggccacaagctggaaatccatagcgggaagaaatgtgttatgcagagaaaaaagtct
cctggggaaactctgtacatttgtgcatgtttggaagaggagtgcaatgaagaattattc
ttcaaagatgacaaagatacaaatatgaatgatactgaccaaagagctctacccagatca
ccaaatgatggcaaatatccagttaaaagtggagtctataaaaatgcacctgttttatgc
aagtcatgtgaaatgagaacaacagcatgcgaaaaagaaggctggtgcaacagctcatgc
gaaactaccaaaaagtgtgaatatggagatgtttgtgtagctatatggagaaataacaac
aacatctttacagaagaatcattatgccataacccatcccagacactgcacgggcatact
ctggatgatcatggctcttcaaactgtattatgaaatcaaaggagacgaatggcgaagca
ttgttcatgtgctcttgtaatgccaatgaatgcaatagtaaattcttcagaggcccgaat
actaaaacgcctaccaaatggaaactaaatgcagtgtgcatgttttgtgacgtgttagag
acaacgtgtgaaaagaaagacaactgtaccagtgtctgcataaagaactccatttgtgct
aataaaggagaaatatgcgtagctatatggaggaatattggtggcaacatcactgaggaa
acaatatgtcatgacccaaaaaatgaactgtatggctattacctggatgactatctttcc
aaagaatgtatcatgaaagagaaaaagacaagtgagggaataatgttcatgtgttcatgc
gatgaagatatgtgtaatgagaggtatattttttctaaagagaaagacattatattagat
gcagacccatcaaaagacatacttctgaaagttcttctgatcactctccttccactggtc
tggattaccattgcagtcattgtcaccttctactgctaccgtgttcagagaacaaaaaag
ctgaaaaagaaatgggacaaaaatccaaagtgcatgcgccatcctgatatggactgcagc
gatgcctgcgcaattatgatagacgatgatcgctccgacatcagctcaacctgtgccaac
aatctaaaccacaatactgagcttcttccgattgaattagacactttggtggggaaaggt
cgatttgctgaagtgtacaaggccaagctaaaacaaaatacatcagaacagtatgaaaca
gtagctgtcaaaatttttcattttgaagagtatgcatcttggaagatggaaaaagatatt
ttttctgacataaatctgaaacatgagaatgtactgcagttcctgacagcagaagagagg
aaaactgacattggcaaacagttttggctcatcactgctttccatgctaaaggcaatctg
caagaatatttaaccaagcatatcatcagctgggaagacctcttgaaacttggaggctct
ttggcccgcggtgttgctcacttgcatagtgatcacactccatgtggcagaccgaagacg
ccaattgttcaccgcgacgtaaagagttccaacatcttggtcaaaaacgacgtgacatgt
tgcttgtgtgactttggcctgtctctttggcttgaaccgtcactttcagtagatgacctt
gcaaacagtggacaggtcgggactgcaagatatatggctccagaggttctagagtctaga
attaatctggacaacatagaatcatttaagcaaactgatgtttattcaatggcgcttgtc
ctttgggagatcacatcccgatgtaatgccaatggagacgtaaaagactacgaacctcca
tttggctcaaaagtgcgggagcacccgtgtattgaaagcatgaaggacaatgtattgaga
gatagagggagacctgaaatctccaacagctggcttagccatcagggaatccagcttgta
tgtgagaccataacagaatgctgggaccaagacccagaagcccgtctcacggctcagtgt
gtagatgaaaggtttaaggaaatgcagaacctcgacagtctttcggagagaagctgttcc
gaagagaagataccagaggactgttcatag

DBGET integrated database retrieval system