KEGG   Xenopus laevis (African clawed frog): 108720066Help
Entry
108720066         CDS       T01010                                 

Gene name
f13a1.S
Definition
(RefSeq) coagulation factor XIII, A1 polypeptide S homeolog
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108720066 (f13a1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core DUF3126
Motif
Other DBs
NCBI-GeneID: 108720066
NCBI-ProteinID: XP_018124930
Xenbase: XB-GENE-6489168
UniProt: A0A1L8FSA8
LinkDB All DBs
Position
6S
AA seq 738 aa AA seqDB search
MSEAKMEKRKSSVPSHTGRSSLPPNFSNADEDEVPTMEAFGVIPRGISMKDYLEVQNVHL
FKQTNEKNKQEHHTDRYYNRKLIIRRGQTFDIQIDFNRPYNPEKDQFWIEYVIGRYPQQS
KGTYIPIPIVDKLEVGKWGAQITRNEYTSVTVTILSTPDCIVGKFRMYVAVLTPYGILRT
IRNAETDTYILFNPWCKDDSVYMDDEQEIEEYVMNDVGVIFHGDVNNIKKRSWEYGQFEE
QILDACLYLMDRAQLDLAGRGNPIKISRVGSAVINSKDDDGVIAGNWKNDYSFGVSPSAW
TGSVDILLEYHSSGLPVKYGQCWVFAGVFNTFLRCLGIPARIITNYFSAHDNDANLRTDV
YLDEDGKTNTSLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQAVDATPQENSDGMFRCGPA
SVQAIKHGHACFQFDTPFIFSEVNSDIVYSRAMKDGSKVIEHVDKAYVGQKILTKQIGGD
SPQDITDLYKFSEGTEEERLALEAALMYGVKKEIRDEDQQQSAPDTDMDFHADNAVFGSD
FKVTLTFKNWSANLYTVSAFLTGHVVFYTGVLKSEFQNKNLKVTLEPSSSKSVEVLIKAH
EYLSKLVEQASLHFFVTARINESKKIMAKQKIVILNVPELHIKVIGEKMVGSEMNILVEF
TNPLKKALQNVALRLGGPGLMRTRTKVFGKIPMNSSLTWEQKCIPQRAGLRKLIATLDCE
TIRHVYGELELEILDNPL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggcaaaaatggagaagagaaagtcttcagttccaagtcacacagggcgtagt
tctctcccaccaaatttctctaatgcagatgaagatgaggttcccacaatggaagccttc
ggtgtcatcccaaggggtattagcatgaaagattacctagaagtccaaaatgtccatctg
ttcaagcagaccaatgaaaagaataagcaggaacatcacactgacagatattacaatagg
aaactcatcatacgacgtggacagacttttgacatccagatagactttaaccggccttac
aatccagaaaaggaccagttttggatagaatatgttataggtcgttatccgcagcagagt
aaaggaacatacataccaatccccattgttgataaactggaagtaggaaaatggggagca
caaattactcgaaatgagtatacatcggttactgttaccatattatcaacaccggattgc
attgttggcaagttccgcatgtatgttgctgtccttactccttatgggattttgcgcacc
atcagaaatgctgagacagacacctatattctcttcaatccatggtgcaaagatgattct
gtttatatggacgatgagcaagaaattgaagaatatgttatgaatgatgttggagtaatt
ttccatggagacgtgaacaacatcaagaaaagaagttgggaatatggacagtttgaagag
cagattcttgatgcatgcctttacctaatggacagagctcaactggatctcgcaggacgt
ggaaatcctattaaaattagtcgtgttggatctgcagtgataaattcgaaagatgatgat
ggcgttattgctgggaattggaaaaatgattattcttttggagtgtccccatctgcctgg
acaggaagtgtagatatcctgttagaataccacagttcaggtcttccagtgaaatatggc
cagtgctgggtctttgctggtgtcttcaatacatttctgcgatgcctgggaatacctgca
cgaattatcaccaattatttctctgctcatgataatgatgccaatctacgtacagatgtc
tacctcgacgaggatgggaaaacaaacacttctctcacaaaggactccatctggaattat
cattgctggaatgaggcttggatgactcgacctgatcttcctgttggctttggaggatgg
caagctgtagatgctacaccacaggaaaacagtgatggtatgttccgatgtgggcctgca
tccgttcaagccattaagcatggtcatgcctgcttccagtttgacacaccgtttattttt
agtgaggtaaacagtgacattgtgtactctagagcaatgaaagatggatccaaagttatt
gaacatgttgacaaagcatacgtgggacaaaagatattgactaaacaaattggcggagat
agcccccaagatataacagacctatataagttttctgaagggacagaggaggagaggctg
gctctggaggctgccctgatgtatggagtcaaaaaggaaattagagatgaggatcagcaa
cagtctgctccagacacagatatggactttcatgcagataatgcagtatttggcagtgac
ttcaaagtcactttaactttcaagaactggagcgccaatctttatacagtatctgctttt
ctcactggacatgtggtcttctataccggggtcctgaagtctgagttccagaacaagaat
ctaaaagtgacattggaaccttcatcctctaaatccgtggaagttctaataaaagcccac
gagtacttgagcaagcttgtggaacaggcctccttacatttttttgtcacggctcgtatt
aatgaatcaaagaagataatggcaaaacagaagattgtgattctgaacgttcctgagctc
catatcaaggttattggagagaagatggttggtagtgaaatgaatattctggtcgagttc
acaaatccattaaaaaaggcacttcaaaatgttgctttgcgtcttggaggacctggactt
atgaggacaagaactaaagtttttgggaaaattccaatgaattcatcactgacttgggaa
cagaaatgcataccacaacgagcaggcctgaggaaattaattgctacgttagattgtgag
acaatacgacatgtttatggagagctagagcttgagatcttggataatccactgtga

DBGET integrated database retrieval system