KEGG   Xenopus laevis (African clawed frog): 373559
Entry
373559            CDS       T01010                                 

Gene name
casp8.L, casp8, casp8-A, xCaspase-8
Definition
(RefSeq) caspase 8 L homeolog
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla04620  Toll-like receptor signaling pathway
xla04621  NOD-like receptor signaling pathway
xla04622  RIG-I-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    373559 (casp8.L)
   04217 Necroptosis
    373559 (casp8.L)
   04115 p53 signaling pathway
    373559 (casp8.L)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    373559 (casp8.L)
   04621 NOD-like receptor signaling pathway
    373559 (casp8.L)
   04622 RIG-I-like receptor signaling pathway
    373559 (casp8.L)
   04625 C-type lectin receptor signaling pathway
    373559 (casp8.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    373559 (casp8.L)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    373559 (casp8.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    373559 (casp8.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     373559 (casp8.L)
Peptidases and inhibitors [BR:xla01002]
 Cysteine peptidases
  Family C14: caspase family
   373559 (casp8.L)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 373559
NCBI-ProteinID: NP_001079034
Xenbase: XB-GENE-865733
UniProt: Q9IB64
LinkDB
Position
9_10L
AA seq 500 aa
MSDLLSSTVDAMNLADMNKLLFEISEDLDKTETLAMIFLCEKRVTAQEKENIKDAKTLFL
CLKKKDLICYNDLSFLKELLYRIGRNDLLRGKLGVRTEEIKRIIEVSPQISPYRILLYDI
SQGLSKKEVEDLKYLLDLSTAKTENASILEIFLELEKVGKLHPDDLQKLKHDLETIGCKN
LSRNIEDYERISEADNHRPENLPDLFEKISVQEEQVNCTAQEPFNGEQRTPQPETESDYC
QPQQHSHMNLETYHLEKNPHGWCVVINNYDFKEARSQDCKYTDREGTAKDAEEITRIFNA
RGYITEEHRDLTAANIQKTLEMYSKKDHAEKDSFVCFILSHGGVGTVCGCDGEEVEIKRL
TKYFNGQHCRSLINKPKIFFIQACQGKESHPKVDMDMDTSFYEPDANGSHLPLEADFLTA
FATVEDYTSLRHRENGSIYIQQLCKALTTYTNQDLIDILTSVNSDVANMLFRLWRKNVTQ
MPSFKSELRKKLILPPPNAM
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgagtgacctgttaagttctacagtggatgcaatgaatctggcagacatgaataaactg
ctgtttgaaataagtgaggatctggacaaaacagaaacccttgcaatgattttcctttgt
gagaagcgcgttactgcccaagaaaaagaaaacatcaaagatgcaaagacattgttcctg
tgtctcaaaaagaaagatttaatatgttataacgatctgtccttcttgaaagagttactc
tacagaattggtagaaacgacctactcagaggcaaattaggggttagaacagaagaaatt
aaaagaattattgaagtatctccacaaatttctccatacaggattttactttatgacatt
tcacaaggtctttctaaaaaagaagtcgaagatttgaaatacttgctggatctgagcaca
gccaaaacagaaaacgcttctatactggaaatattcttggaactggaaaaagttggaaaa
ttacatcccgatgatctacagaagctaaaacacgatttagaaacaattggttgtaaaaac
ctttctaggaacattgaagactatgaaagaatatcagaagctgataatcacaggccagaa
aacctaccagatttatttgagaagatttcagtacaagaggagcaggttaattgtactgca
caagaacccttcaatggggagcaaaggacaccccagcctgaaactgaaagtgactattgc
caaccccaacaacactctcatatgaatttagagacctaccacttggagaaaaatcctcat
ggctggtgtgtggtcataaataattacgacttcaaagaggcaaggtctcaggattgtaaa
tatactgacagagaaggaacagcgaaggatgcagaggagattacaaggatatttaatgcc
cggggctacatcacagaagagcacagggatctaactgctgcaaatatacagaaaaccttg
gagatgtatagtaagaaagatcatgcagagaaagacagctttgtgtgctttatcctctct
catggtggggtaggaactgtatgtggctgtgacggagaagaggtggaaatcaagagattg
acaaaatattttaatggtcaacactgtcgctctctcattaataaaccaaagattttcttc
atccaagcttgtcaggggaaagaatcacatccaaaagttgatatggatatggatacttct
ttttatgaaccagatgcaaatggaagtcatctacccctagaagcagactttttaaccgca
tttgcgacagttgaagattatacaagtctaagacatagagaaaacggtagcatttatatt
cagcaactgtgcaaggccttgacaacttacacaaatcaagacctgatcgatatactaacc
agtgttaatagtgacgttgcaaacatgctgttccgtttatggaggaagaatgtaacacag
atgccctcatttaaatcagagttacgcaaaaaacttattctgccacctcctaatgccatg
taa

DBGET integrated database retrieval system