KEGG   Xenopus laevis (African clawed frog): 373560
Entry
373560            CDS       T01010                                 

Gene name
casp9.S, casp9, casp9-A, caspase9, iCasp9, xCaspase-9
Definition
(RefSeq) caspase 9 S homeolog
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04370  VEGF signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    373560 (casp9.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    373560 (casp9.S)
   04115 p53 signaling pathway
    373560 (casp9.S)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    373560 (casp9.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    373560 (casp9.S)
   01002 Peptidases and inhibitors [BR:xla01002]
    373560 (casp9.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     373560 (casp9.S)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     373560 (casp9.S)
Peptidases and inhibitors [BR:xla01002]
 Cysteine peptidases
  Family C14: caspase family
   373560 (casp9.S)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 373560
NCBI-ProteinID: NP_001079035
Xenbase: XB-GENE-865017
UniProt: Q9IB63
LinkDB
Position
7S
AA seq 399 aa
MEQELRDILRRNRVRLVQSLQVKELWDLLVERGVFSNDMIEEIQREGTRRDQARKLLVEL
ETRGSQAFPLFLLCLKETAQHDLADFLQSDSGTRVLQPIPTTPSPVLKPLPKAEPAEYPA
REIRSRKGTLDKDKDYPMSSDPIGFCLIINNMNFHECTGLSTRTGSDIDRDKLANRMRSF
HFEVTVKDNLTGQAMHDHLQALADQDHSLQDCCLVVILSHGCETRHIQFPGGVYGTDGIR
IPVERIVSYFNGSKCPSLRGKPKIFIIQACGGDQKDKGCEVTSETPPLSPTSTSLQSDAT
PVFSGEGDRDEVDAVSNIPTPSDILVSYSTFPGYVSWRDKHTGSWYVEVLDSVLAEHAAA
DDLQSLLVMVADGVSSKGTYKQIPGYFNFLRKRFYFKTD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggagcaggaattaagggatattttgaggcggaatcgggtccgtttggtccagtctctt
caggttaaagagctgtgggatctcctggtggagagaggagtcttcagcaatgacatgata
gaggagatccagagagaagggacacggagggaccaggcccggaagctgctggtagagctg
gaaacacgtgggagccaggcattccctctctttctgctgtgcctaaaggagactgctcag
catgatctggcagatttcctccaatcagacagtggcacacgggtcttacagcccattcca
acaactccaagcccagtgctgaaacctctacccaaagcggagcctgctgagtatcctgca
agagagatcagaagtagaaaaggaaccctggacaaagacaaggattatcccatgtcatcg
gaccccattggattctgcctcattattaacaacatgaatttccatgaatgcactggatta
tccaccagaactgggtcagacatagaccgggacaagctggccaacagaatgcgctccttt
cactttgaggtcacggtgaaggataatctgacggggcaggccatgcatgatcatctgcag
gcacttgctgaccaagaccacagcctgcaggactgctgcctggtggtgatcctgtcccat
ggctgtgagacccggcacattcagttcccaggaggggtttatggaacagatggaatacga
attcccgtagagagaatcgtgagctacttcaatggttccaaatgccccagtctgcgtgga
aagcccaaaattttcatcatccaagcctgcggcggagatcagaaagacaaaggatgtgag
gtgacttccgagaccccaccactgagccccacttcaacttccctgcagtctgatgccacc
cctgttttctctggggaaggtgacagggatgaagtggatgctgtgtccaatattcccact
cccagtgatatcttggtgtcttattccactttcccaggctacgtgtcatggagggataaa
cacacaggatcgtggtatgtagaggtgctggacagtgtccttgcagaacatgcagctgca
gatgacctacagtcccttttagtgatggtcgccgatggagtttcaagcaaaggaacctac
aagcaaatccctggatactttaatttccttcggaagcgattttactttaagaccgattga

DBGET integrated database retrieval system