KEGG   Xenopus laevis (African clawed frog): 373760
Entry
373760            CDS       T01010                                 

Gene name
kitlg.S, Xkl-1, Xsl, Xsl-1, Xsl-2, kitlg, scf-a, sl-2, steel
Definition
(RefSeq) KIT ligand S homeolog
  KO
K05461  KIT ligand
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    373760 (kitlg.S)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    373760 (kitlg.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    373760 (kitlg.S)
Cytokines and growth factors [BR:xla04052]
 Growth factors
  Growth factors (RTK binding)
   373760 (kitlg.S)
SSDB
Motif
Pfam: SCF LapA_dom
Other DBs
NCBI-GeneID: 373760
NCBI-ProteinID: NP_001079174
Xenbase: XB-GENE-17341318
UniProt: Q8AYN7
LinkDB
Position
3S
AA seq 270 aa
MKKTKTWIIICINLQLFLHCFGKPCGNPITDAVNDIPKLVGNIPNDYNMSVRYVPEKDGL
PKHCWLYMMVVEMTHNLDKLSSKFENTSQNVLIIKNLSWIFQGIRQCIQLNDEMDFDSAS
SLYRVEVIKARDFFSYVTSTIEVFKEINDTEYSRLCILPQEYEFEYTTEDDFLILDSNHD
LPYVPSTRKNSSRFDSSARSGFSTGTSIQYSTVLIALACLVIGFLLGVLCLWKFKHRQTQ
TQDNLSAVAVEPRAENESRHILQLAKIISV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaagaagacaaaaacttggattatcatatgcattaatcttcaactgtttctccattgc
tttggaaaaccgtgtggaaacccaatcactgatgctgttaatgacattccgaaactggta
ggaaatattccaaatgattacaatatgagtgtgagatatgttccagaaaaagatggtctg
ccaaaacattgttggttgtatatgatggtcgttgaaatgactcataacctagataaatta
tcatcaaaatttgaaaatacatcacagaacgttttgattataaagaacctttcctggatt
tttcaaggcatcagacaatgtatccaactcaatgatgaaatggactttgactcggcctct
tctttgtatcgagtagaagtaatcaaagccagagattttttcagttatgtgactagtaca
attgaggtttttaaagaaatcaacgacacagagtattcaagactttgtatcctgcctcaa
gaatatgaatttgagtatactactgaggatgattttctaattcttgactcaaatcatgat
ctgccatatgttccaagcacacgaaagaatagtagcagatttgattcatctgccaggtcc
ggattcagcactggtacatctatacagtacagtacagtgttaatagcactggcctgccta
gtcattggatttttattaggagtcttgtgcttgtggaagtttaaacacagacaaactcag
acacaggataacctgtctgcagttgcagttgaaccaagagctgaaaatgaatcacgacat
atattgcaactggcgaaaattatctcagtgtaa

DBGET integrated database retrieval system