KEGG   Xenopus laevis (African clawed frog): 373803Help
Entry
373803            CDS       T01010                                 

Gene name
gng7.L, gng7, gng7-a, gng7-b
Definition
(RefSeq) guanine nucleotide binding protein (G protein), gamma 7 L homeolog
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    373803 (gng7.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    373803 (gng7.L)
   04031 GTP-binding proteins [BR:xla04031]
    373803 (gng7.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373803 (gng7.L)
  Exosomal proteins of other body fluids (saliva and urine)
   373803 (gng7.L)
GTP-binding proteins [BR:xla04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    373803 (gng7.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 373803
NCBI-ProteinID: NP_001079196
Xenbase: XB-GENE-969606
UniProt: Q801T2
LinkDB All DBs
Position
1S
AA seq 68 aa AA seqDB search
MSTSNNIAQARKLVEQLRLEAGIERVKVSKAAADLMNYCEQHAKNDPLLVGMPTSENPFK
DKKPCSIL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctctaataacatagcacaggctcggaagctggtggagcagctgagacttgag
gctggaatagagagagttaaggtctccaaagctgccgcagaccttatgaactactgtgag
caacatgccaaaaatgaccctctgctggttggaatgccaacttcagagaatccatttaaa
gataaaaagccatgttccattttataa

DBGET integrated database retrieval system