KEGG   Xenopus laevis (African clawed frog): 378529Help
Entry
378529            CDS       T01010                                 

Gene name
dcc, CRC18, CRCR1, XDCCa, dcca-A, xdcc
Definition
(RefSeq) deleted in colorectal carcinoma
  KO
K06765  deleted in colorectal carcinoma
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set C2-set_2 Ig_4 DUF2369 Ig_6 Protocadherin EphA2_TM TMEM154 FAM176 CD34_antigen
Motif
Other DBs
NCBI-GeneID: 378529
NCBI-ProteinID: NP_001079254
Xenbase: XB-GENE-866448
UniProt: Q91562
LinkDB All DBs
Position
1L
AA seq 1427 aa AA seqDB search
MENCLGFYSLPKLVFLLYGFTLLNLNLTVSGSQVKSFTSLWFLSEPSDAVTMRGGNVVLN
CSAQSDRGAPIIKWKKDGVYLNLVIDERRQQLPSGSFLIQNVVHSRHHRPDEGVYQCEAS
LDSVGTIVSRTAKVLVAGPLRILSQTESVTAFVGDTALLRCEITGEPMPTISWQKNEEDL
KVTPGDPRLLVLPSGTLQISRLQTADGGVYRCLAKNPGSARVGNEAELRILSESGLHRQQ
VFLQRPSNVVAIEGQDAVLECAVSGYPTPTIVWMQGDEPVPIRTRKYSVLGGSNLLISNV
TDDDAGAYTCVATYKNENTSFSADLTVMVPPQFLNHPANLYAYESMDIEFECAVSGKPSP
TVKWTKNGEVVIPSDYFQIVDGSNLRILGLVKSDEGYYQCIAENEAGNIQTYAQLIIPDP
AVPSSSILPSAPRDVVPVLVSSRFVRLSWRPPVESKGNIQTYTVYFSKQGVQRERAVNTS
QPISLQITVGNLTPEETYNFRVVAYNEWGPGESSQEVKVVTQPELQVPGPVENLQVVSTA
PTSVLISWDPPAYANGPVQGYRLFCAETFSGREQNIEVDGIVYRLEGLRKFTEYSIRVLA
YNRYGPGVSSEEHTVVTLSDVPSAMPQNVSLEVANSRSIKVSWLPPPPGTQNGFITGYKI
RHRKTTRRGELETLEPNNLWYLFTGLEKGSQYSFQVAAMTVNGTGPSSDWYTAETPENDL
DESQVPDQPSSLHVRPLTTSIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIENLEPSSHYVISLKAFNNAGEGVPLYESATTRSQTVPDMSTPMLPPVGVQAVALTHD
AVRVSWADNSVLKNQKTTEVRFYTIRWRTSYSASSKYKSADTTSLSHTVTGLKPNTMYEF
SVMVTKGRRSSTWSMTAHATTYETAPTSAPKDLTVITRERKPRAVIVSWQPPIEANGKII
DFILFYTLDKNLQLDDWIMVTITGDRLTHEILDLNLDTAYYFRIQARNAKGLGPLSEPIT
FRTPKVEHPDKMANDQGRHGDGGYWSVDTNLIDRSSLNEPPIGQMHPPHGSVTPQKNSNL
LVIIVVTVGAITILVVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHE
EMEMKNIEKPSGSDTQGRDSPRQSCQDITPVSHSQSESQLGSKSTSHSGPDADEVGSNIS
TLERTLAARRATRAKLMIPMDSQPSSNPPVVSAIPVPTLESAQYPGILPSPTCGYPHPQF
TLRPVPFPTLTVDRGFGTSRVTEVPASQQSSVLSHPQPEHSTSEDAPSRTIPTACVRPTH
PLRSFANPLLPPPMTAMEPKVPYTTLLSQTGSGLSKAQVKTASLGLAGKARSPLLPVSVP
TAPEVSEESHKHTDDPSSVYEQDDLSEQMASLEGLMKQLNAITGSAF
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atggagaattgtcttggattttattcactaccaaagctggtgtttctcctgtatggattc
actctgctcaacctaaatctcacagtatctggttcacaggtcaagagttttacatcctta
tggttcctgtctgaaccatccgatgctgttaccatgcgtggaggtaatgttgtactgaac
tgctcagcacaatctgatcggggagcaccaataatcaagtggaagaaggatggagtttat
ctgaatctggtaatagatgaaagaagacagcaactcccgagtgggtctttcctcatacag
aatgtggtccactccaggcaccacaggccggatgagggtgtttaccagtgtgaagcttcc
ttagatagtgttggaacaatagtcagccggacagctaaagtactagttgcaggtccactg
agaattctctcccagacggagtctgtcacagcatttgtgggagacacggcattgttacgg
tgtgaaatcacgggggagcccatgcccaccatatcttggcagaaaaatgaagaggatctg
aaagtgacacccggggacccccgtctgcttgtgctcccctcggggacattacagattagc
agactccaaacggcagatggtggggtttatagatgtttggcgaaaaatcctggcagtgcc
agagtaggaaatgaagctgaactccgcattctgtcagaatcggggttacacagacagcaa
gtctttctgcagcgaccgtccaatgttgttgctatcgaaggacaagatgcggtactggaa
tgcgctgtttctgggtatccaacgccaaccatcgtatggatgcaaggagatgaacctgtg
ccaatcaggacaaggaaatactctgtgctgggaggcagcaatctactaatttccaacgta
acagatgacgacgcaggagcgtacacgtgtgtggctacctacaagaatgaaaacaccagt
ttttctgcagatctcactgttatggtgccaccacagtttttaaatcatcctgcaaacctt
tatgcctatgagagcatggatattgagtttgaatgcgctgtttcaggaaaaccttctcct
acagtcaagtggaccaaaaatggtgaagtggtcatccccagtgactactttcagattgtg
gatggcagtaacctaagaattctgggactggtgaagtcagatgaaggctattaccaatgt
atagctgaaaatgaggctgggaatatccaaacctatgcacagctaatcatccctgatcct
gctgtccccagttccagtatcctcccctctgctccccgagatgtggtccctgtcttggtt
tccagtcgatttgttcgtcttagctggaggccacccgttgagtccaaagggaacatacag
acatacacggtctacttctccaagcaaggagtacaaagggaacgggctgtgaatacatca
caacctatatcactgcagataaccgtggggaatctaacaccggaggagacctacaatttt
cgagtggtggcctataatgaatggggtcctggagaaagttcccaagaggtcaaagttgta
acccaacctgaattgcaagttccaggacccgtggagaatcttcaagttgtctctactgca
cctacctcagtcttgatttcttgggatccccctgcttatgcaaatggccctgttcaagga
tacagattgttttgtgcagaaactttttcagggagagaacagaatatcgaagtggatgga
attgtatacagacttgaaggacttagaaagttcacagagtacagtatacgagtcttggcc
tacaatcgctatgggcctggagtgtcttctgaagaacatacagttgtcaccctttctgac
gtgcccagtgccatgccacagaatgtctccttggaagtcgctaactccaggagtataaaa
gtcagctggttacctcctccaccgggaacacaaaatggattcattacaggctacaaaatt
cggcatagaaagacaacccggaggggggaacttgaaactctagaacccaacaacctctgg
tatctcttcacaggacttgaaaaaggaagccaatacagttttcaagtggctgctatgact
gtaaatggaactggaccctcttcagactggtacacagctgaaacaccagagaatgatctt
gatgaatcccaggttccagaccagccaagttctcttcatgtaagaccattaacaaccagt
atcattatgagttggactccaccgctgaaccccaacattgtagtgagaggctacattatt
ggctatggagttggaagcccatatgcagaaacagtcagggtggacagcaaacagcgatat
tattcgattgaaaatttagagccaagctcccattatgtcatttcactaaaagcttttaat
aatgctggggaaggcgtccctctctatgaaagtgccaccactcgatcacaaacagtccca
gatatgtccacccccatgctcccaccagtaggtgttcaggcggttgcacttacgcatgat
gcagtgagagtcagctgggcggacaactctgtccttaagaaccaaaagacgaccgaagtg
cgtttctatactatacgctggagaacgagctactcagccagttcaaaatataagtctgct
gacacaacatctctaagtcatactgtaacgggcttgaagccaaacaccatgtatgaattt
tcagtaatggtcacaaagggtagacgctcaagcacttggagtatgacagctcatgccact
acttacgaaacagctccaacatctgccccgaaggacttgacagttatcacaagggaaagg
aagcctcgagctgttattgtgagctggcagcctccgatcgaagccaacggcaaaattatt
gatttcatacttttctacactttggacaagaacctgcagctagatgactggatcatggtg
acaataactggtgacagattaactcatgaaattctggatctaaacctagacactgcctac
tattttagaatccaggcacgcaacgccaaaggattgggacctctgtctgaaccaattact
tttcggacgcctaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatgga
gatggagggtactggtcagtagatacaaacttgattgacaggagcagcctcaatgagcct
ccgataggacaaatgcacccaccacatggcagtgttaccccacagaaaaacagcaacttg
ttagtcattattgtggtgacggttggggctattacgattctggtggtggtaatcgtagcg
gtgatctgtacacggagatcttcagcccagcagaggaaaaaacgcgccacgcacagcgct
ggcaagcgaaaaggcagccaaaaagatctgcggcctcctgacctttggatccaccatgag
gagatggaaatgaagaacattgaaaagccatctggatcggacacgcaaggaagggactcc
ccaaggcaaagctgtcaagatataactcctgttagccacagtcaatcagaatcacagctg
ggcagcaaaagcacatcacattctggcccagatgcagatgaggttggaagcaacatctca
acattggagagaactcttgctgcccgccgagccacaagggccaaactcatgatcccgatg
gactcacagcccagcagtaaccctcctgttgtgagtgccattcctgtgccaactctagaa
agtgcccagtatcctggcatccttccatcaccaacatgtggctacccacacccgcagttt
actctacgaccggtaccctttcctacactcactgtggacaggggttttggaacttctcga
gtgactgaggtcccagcttcccaacagtcatcagttctgtcacaccctcaaccagaacat
tccactagtgaagatgctccaagcagaacaatccccactgcctgtgttcggccaacgcac
cctctccgaagttttgcaaatcccttgttgccgccaccaatgactgcaatggaacctaaa
gttccttatacaactctgttgtctcaaacagggtccggcctttccaaggcacaagtaaag
acagcatcattggggctggcaggtaaagcaaggtctccgctactccctgtatcagtgcca
acagcgccagaggtttcagaagaaagccacaaacacacagatgacccttccagtgtctat
gaacaggatgatttgagtgaacaaatggccagcttggaggggttgatgaaacagctaaat
gccatcacgggatcagctttttaa

DBGET integrated database retrieval system