KEGG   Xenopus laevis (African clawed frog): 378542Help
Entry
378542            CDS       T01010                                 

Gene name
hesx1.S, XANF-2, Xanf, Xanf-1, Xanf1, Xanf2, anf2, anf2-A, hesx1, hesx1-a, hesx1-b, rpx
Definition
(RefSeq) HESX homeobox 1 S homeolog
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    378542 (hesx1.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    378542 (hesx1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 378542
NCBI-ProteinID: NP_001079264
Xenbase: XB-GENE-6252654
UniProt: Q91617
LinkDB All DBs
Position
Un
AA seq 183 aa AA seqDB search
MSTGLQKGSRLMENRSPPSSFSIEHILGLDKKMDVASSPIIKHHRPWIECSSKVDGTFWQ
IPLISYDLPVQVDAMRRSAEEETKIRLDRGEEDRLTYKREQSWYRGRRPRTAFTRGQIEI
LENVFRVNSYPGIDVREELASKLALDEDRIQIWFQNRRAKLKRSHRESQFLIVKDSLSSK
IEE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtctccagaaaggatcccgtctgatggaaaatagatctcctccatcttca
ttttccatcgaacatattttaggattagacaagaagatggatgtggcttcatcacccatt
ataaagcaccaccggccgtggattgagtgcagcagcaaggttgacggcaccttttggcaa
atcccattgatcagctatgaccttcccgtacaagttgacgccatgcgccgatccgcagaa
gaggagacaaagatccgactggatcgcggcgaagaggacagactgacctacaagagagaa
cagagttggtaccgggggcgaagaccccgaactgctttcactagaggccagattgaaata
ttggagaacgtgttcagagtgaattcctatccaggcattgacgtcagagaagagctggcc
agcaaattagctcttgatgaagataggatccagatctggtttcaaaatcgccgtgcaaaa
ctcaaaaggtctcaccgggaatcccagttcctgattgttaaagactcactatcatcaaag
atagaagaatga

DBGET integrated database retrieval system