KEGG   Xenopus laevis (African clawed frog): 378598
Entry
378598            CDS       T01010                                 

Gene name
nr3c1.L, gccr, gcr, gcr-a, grl, nr3c1, nr3c1-a, nr3c1-b, xGR
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1 L homeolog
  KO
K05771  glucocorticoid receptor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    378598 (nr3c1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    378598 (nr3c1.L)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xla03310]
    378598 (nr3c1.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    378598 (nr3c1.L)
Nuclear receptors [BR:xla03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   378598 (nr3c1.L)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 378598
NCBI-ProteinID: XP_018111659
Xenbase: XB-GENE-6252633
UniProt: A0A1L8GV81
LinkDB
Position
3S
AA seq 761 aa
MDPKDLLKPSSGSQAVKGSPHYNDKPGNVIEFLGNYRGGVSVSVSASCPTSTASQSNTRQ
QLFNKPQTATGDSTNGLNNVPQADLSKAVSLSMGLYTGESDTKVMGSDIAFPTQDQIGIS
TGETNFSLLEESIANLQAKSLAPDKLVEISEVPGVFKSALPRPSILGQGGSNGSSTTKLF
PKDQITFDLLQDLDIQPDSLMDGKGNPWLDPLFDEEEALSLLSPLGTGDPFFMKSEVLSE
GSKPLGLADGTQRLGDLPVTQVKTEKEDYIELCTPGVVKQEKFGPVYCVGNFSGSGLFGN
KSSGISVHGVSTSGGQMYHYDLNSSTMTQQDLKPIFNLSSPGTSIAEGWNRCHGSSDDGA
ASPGNVHFANRSLFSNGFSSPGIRPDLSPSPSTSSTSTGPPPKLCLVCSDEASGCHYGVL
TCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKK
IKGIQQPTAAAARESNETSMTRTMVPASVAQLTPTLISLLEVIEPEVLFSGYDSSMPDTT
RRLMSSLNMLGGRQVVSAVRWAKAIPGFRNLHLDDQMTLLQYSWMFLMVFALGWRSYKQT
NGSILYFAPDLVITEDRMHLPFMQERCQEMLKIAGEMSRLQISYDEYLCMKVLLLMCTIP
KEGLKSHALFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVAENLLAFC
FLSFMDKSMSIEFPDMLSEIISNQIPKYSSGNIKKLLFHQK
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggaccccaaagaccttttgaagccctccagcggatctcaggcagtgaagggctcgcct
cattacaacgacaagccagggaatgtgattgaattcctgggaaattacaggggaggagtt
agtgtgagtgtctctgcatcttgtccaacctcaactgcttcacagtcaaacactaggcag
cagctttttaataaaccgcagactgcgactggggattcaacgaatggattgaataatgtg
cctcaggcagatttgtctaaagcagtctcgctctcaatgggactctacacgggggagtca
gacacaaaagtgatgggcagtgatatcgcctttccaacccaagatcaaatcggtatctcc
acaggagaaactaattttagtctcttggaagagagcattgccaacttgcaggctaagtca
ttggccccagataaactcgtagagatctcggaggttcctggggtttttaaatctgcccta
ccacggccttccatactaggtcaggggggcagcaatggaagcagcactactaagctgttt
cccaaagaccaaatcacctttgacctattacaagacctggatatccagccagactcactc
atggatggtaaaggaaatccttggctagacccactttttgatgaggaggaagctcttagc
cttttgtccccactgggcactggtgatccttttttcatgaaatctgaagtactgagtgag
ggtagcaaacctctcggcctcgctgatggcacacagagactcggagatctaccagttact
caagtcaaaacagaaaaagaagactacattgagctttgtacacctggtgtggtgaagcag
gaaaagtttggccctgtttattgtgtaggcaatttttcaggatctggcttatttggaaac
aaatcctccggtatttctgtccatggtgtcagcacttcaggtgggcagatgtaccactat
gacttgaactcttccaccatgacgcaacaggatcttaagcctatctttaatcttagctca
cccgggactagcattgcagaaggctggaataggtgccatggatcaagcgatgacggtgcc
gcttctccagggaatgtacattttgcaaacagatctcttttttcaaatggcttttcaagc
cccggaataagacctgatctaagtccgtctccatccacctcttctaccagcacggggcca
ccccccaagctctgtttggtgtgctctgacgaggcttctgggtgtcactatggagtactg
acttgcggcagctgtaaagttttctttaagagagcagttgaaggtcagcataattatctt
tgcgccggacggaacgactgcattattgataaaataagaaggaagaactgccctgcgtgt
cgctaccggaagtgtcttcaagctggaatgaaccttgaagctcggaaaacaaagaagaaa
attaaaggaattcagcaacctactgcagctgcagcacgggagtctaatgagacttctatg
accaggaccatggtacctgcatctgtggcacaactcacaccaaccctgatctcattattg
gaggttattgagccagaagtgctattttctggatacgacagctccatgcctgacacaacc
aggaggcttatgtcttctcttaacatgcttggtggcaggcaagtggtgtctgctgtcaga
tgggcaaaggcaattccaggtttcagaaacttgcacctggatgaccaaatgacccttctt
cagtactcgtggatgtttttgatggtgtttgctcttggatggaggtcttacaagcaaacc
aatggaagtattctgtattttgctccagatctcgtcattactgaggacaggatgcaccta
ccctttatgcaagagagatgtcaagagatgttgaagattgcaggtgaaatgtcccgtctt
caaatttcatatgatgaatatctctgcatgaaagtcctgttgctcatgtgcacaattcca
aaggaaggcctgaagagccatgctctctttgaggaaatccgtatgacatacattaaagag
ctgggaaaagccatagtaaagagggaaggaaattccagtcaaaactggcagcgcttttac
caactgacaaagctattggactccatgcatgaggtggctgagaatctactagccttttgc
ttcctttccttcatggataaatcaatgagtatcgaatttccggatatgttgtcagaaatc
atcagcaatcagataccaaaatattcatctggaaacatcaaaaaactgttatttcatcaa
aagtga

DBGET integrated database retrieval system