KEGG   Xenopus laevis (African clawed frog): 378602Help
Entry
378602            CDS       T01010                                 

Gene name
gck.L, gck, gck-A, glk, hhf3, hk4, hkiv, hxkp, mody2
Definition
(RefSeq) glucokinase (hexokinase 4) L homeolog
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00052  Galactose metabolism
xla00500  Starch and sucrose metabolism
xla00520  Amino sugar and nucleotide sugar metabolism
xla00524  Neomycin, kanamycin and gentamicin biosynthesis
xla01100  Metabolic pathways
xla01200  Carbon metabolism
xla04910  Insulin signaling pathway
Module
xla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xla_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    378602 (gck.L)
   00052 Galactose metabolism
    378602 (gck.L)
   00500 Starch and sucrose metabolism
    378602 (gck.L)
   00520 Amino sugar and nucleotide sugar metabolism
    378602 (gck.L)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    378602 (gck.L)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    378602 (gck.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     378602 (gck.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 378602
NCBI-ProteinID: NP_001079298
Xenbase: XB-GENE-981994
UniProt: Q91753
LinkDB All DBs
Structure
PDB: 

Position
3L
AA seq 458 aa AA seqDB search
METFDQNEVDQILSEFHLQEEDLHVLMCRMQAEMERGLHLETNEEASVKMLPTYVRSTPD
GSEVGDFLALDLGGTNFRVMLVKVGEDLEGQWKVETKHKMYSIPVDAMTGTAEMLFDYIA
ECISDYLDQQNMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRD
AIKRRGDFEMDVVAMVNDTVATMISCYYEDHHCEVGLIVGTGCNACYMEEMSNVELVEGE
EGRMCVNTEWGAFGDTGELEDFRLEYDRVVDEASLNPGQQLYEKMIGGKYMGELVRLVLI
KMVNENLLFGGESSEKLKTRGAFETQFVSQIEADTSDFKQTLNILRTLGVQATIGDCHAV
RLACESVSTRAAIMCSAGLAGILNRMRQSRREELLRITVGVDGSVYKLHPSFKDKFHATV
LKLTSGCEITFIQSEEGSGRGAALISAVAYKMAVMIGH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatttgaccagaatgaggtggatcagatcctgtctgagttccatctgcaggag
gaagatttgcatgttctgatgtgcaggatgcaggctgagatggagaggggtcttcacctg
gaaaccaatgaggaggccagtgttaaaatgctgcccacctatgttcgctcaacacctgat
ggctctgaggtgggtgacttcctagccctggaccttgggggcaccaacttccgtgtcatg
ttggtaaaggttggggaggatttggaagggcagtggaaagtggagacaaaacacaaaatg
tattcaattccagtggatgccatgactggaacagcagagatgctatttgactacattgca
gaatgcatttctgattacctggaccagcaaaacatgaagcacaagaaactgcccttggga
tttactttctctttcccggttagacatgaggatatcgacaagggtattcttctcaattgg
accaaaggattcaaagcatctggagcagaaggaaacaatgttgttggacttctcagagat
gcaatcaagagacgtggtgattttgaaatggatgtggttgccatggtaaatgatacagtg
gctactatgatatcttgttactatgaagaccatcactgtgaggttggcttgatcgtaggg
actggctgcaacgcttgctacatggaggagatgagtaatgtggagctggtggaaggagag
gagggacgtatgtgtgtgaacacggagtggggagcatttggagacacgggggagctggag
gatttccgactagagtacgaccgagtggtggatgaggcatctcttaatcctggtcagcaa
ctctacgaaaagatgattggtggaaaatacatgggggagctggtcagactggtcctgata
aagatggtgaatgagaatctgttatttggaggagaatcttctgaaaagctgaagacccga
ggagccttcgaaacacaatttgtgtcccagatagaggcggacacctccgattttaaacag
actctcaacatcctgcggactctaggagtacaggccacaattggagactgtcatgctgtg
cgcttagcatgtgagagtgtatctactcgagctgccatcatgtgttctgctggccttgct
gggatactaaaccgcatgcggcaaagcaggagagaggagctacttcgaattactgtggga
gtggatggatctgtgtacaaactacaccctagttttaaggacaagttccatgccactgtg
ctcaaactgacttcaggctgtgaaattaccttcattcagtcagaggaaggaagtggacgt
ggagctgccctaatatcagcagtggcgtataagatggctgtcatgattggtcactag

DBGET integrated database retrieval system