KEGG   Xenopus laevis (African clawed frog): 379052
Entry
379052            CDS       T01010                                 

Gene name
myc.S, X-cmyc, Xcmyc, c-myc, cmyc, myc-a, myc-b, myc1, mycI
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog S homeolog
  KO
K04377  Myc proto-oncogene protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    379052 (myc.S)
   04012 ErbB signaling pathway
    379052 (myc.S)
   04310 Wnt signaling pathway
    379052 (myc.S)
   04350 TGF-beta signaling pathway
    379052 (myc.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379052 (myc.S)
   04218 Cellular senescence
    379052 (myc.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    379052 (myc.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    379052 (myc.S)
   03019 Messenger RNA biogenesis [BR:xla03019]
    379052 (myc.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    379052 (myc.S)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     379052 (myc.S)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ DUF3091
Other DBs
NCBI-GeneID: 379052
NCBI-ProteinID: NP_001079365
Xenbase: XB-GENE-6053022
UniProt: Q2TAU1
LinkDB
Position
6S
AA seq 419 aa
MPLNANFPSKNYDYDYDLQPCFFFLEEENFYHQQSRLQPPAPSEDIWKKFELLPTPPLSP
SRRSSQSSLFPSTADQLEMVTEFLGGDMVNQSFICEADDEALLKSIVIQDCMWSGFSAAA
KLEKVVSEKLASYQASRKESALSSSSPCPSQPPPSPLKSPSCHGSLSLGGTHRSSHGFLQ
DPSSDCVDPSVVFPYPLNDSISNASSPCQDLILETPPISSNSSSSESEEEPEDEDEDCDE
EEEIDVVTVEKRQSASKRVESSSHSQPSRPHYSPLVLKRCHVPIHQHNYAASPSTKVDYV
SSKRAKLESNIRVLKQISNNRKCASPRSSDSEENDKRKTHNVLERQRRNELKLSFFALRD
QVPEVASNEKAPKVVILKKATEYAISLQEDERRLIRETEQLKYRKEQLKQRLQQLRNFV
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcctcttaatgccaattttcccagcaagaactacgactacgattatgacttgcagccc
tgcttcttctttctggaggaggagaacttctaccaccagcaaagccgactgcagccgccg
gcccccagtgaggacatctggaagaagtttgagctgctccccaccccgcccttgtcaccc
agccgcagatccagccagtccagccttttcccctccacggctgatcagctggagatggtg
accgaattcctgggaggggacatggtcaaccagagctttatctgcgaggcggatgacgaa
gccttgctgaagtccatcgtcatacaggactgtatgtggagtggattttcggctgcggcc
aagctggagaaagtggtgtctgagaagctggcgtcctaccaggcttctaggaaagagagt
gctctgtcttcttcttctccgtgtccgagtcaaccaccaccgagcccgcttaagtctccc
tcgtgtcatgggagcctgagtctgggagggacccacaggagcagccatggttttctccag
gaccccagctcggattgtgttgacccttcagtggtcttcccatacccactgaacgacagc
atttccaacgccagctctccttgccaagatctcattttggaaacaccgcccatcagcagt
aacagcagcagcagtgaatctgaagaggaaccagaagatgaggatgaagactgcgacgag
gaagaggagattgacgttgtcacagtagaaaaaaggcagtcggcatccaagcgggtggaa
tccagttctcattcgcagccctcccgaccccactacagccctttagttctgaagcggtgt
cacgttcccattcaccaacacaactacgcggcgtctccctcgaccaaagtggactatgtt
tcttccaaaagggcgaaactagaaagcaacatccgggtcctcaaacagatcagcaacaac
cgcaagtgcgccagtcccaggtcctcggattccgaagagaacgacaagaggaagacgcac
aacgttctggagcgccagaggcggaacgagctcaagttgagtttttttgccttgcgcgat
caggtaccggaggtggcgagcaacgagaaggcccccaaagtagtcatcctcaaaaaggca
acggaatacgccatttctctgcaggaggacgaacggcggctcatacgggaaacagaacag
ttaaagtacaggaaagagcagttaaaacagagactccaacagctgaggaactttgtctaa

KEGG   Xenopus laevis (African clawed frog): 399315
Entry
399315            CDS       T01010                                 

Gene name
myc.L, X-cmyc, Xcmyc, c-myc, c-myc_II, cmyc, myc, myc-B, myc-a, myc2
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog L homeolog
  KO
K04377  Myc proto-oncogene protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04350  TGF-beta signaling pathway
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    399315 (myc.L)
   04012 ErbB signaling pathway
    399315 (myc.L)
   04310 Wnt signaling pathway
    399315 (myc.L)
   04350 TGF-beta signaling pathway
    399315 (myc.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    399315 (myc.L)
   04218 Cellular senescence
    399315 (myc.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    399315 (myc.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    399315 (myc.L)
   03019 Messenger RNA biogenesis [BR:xla03019]
    399315 (myc.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    399315 (myc.L)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     399315 (myc.L)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ DUF3246 CENP-B_dimeris
Other DBs
NCBI-GeneID: 399315
NCBI-ProteinID: NP_001084122
Xenbase: XB-GENE-6256575
UniProt: P15171
LinkDB
Position
6L
AA seq 420 aa
MPLNANFPSKNYDYDYDLQPCFFFLEEENFYHQQSRLQPPAPSEDIWKKFELLPTPPLSP
SRRSSQSSLFPSTADQLEMVTEFLGGDMVNQSFICEADDEALLKSIVIQDCMWSGFSAAA
KLEKVVSEKLASYQASRKESALSTSQCQSQPPQSPLKSPSCDGSLNLGGTNRSSHEFLQD
PSSDWVDPSVVFPYPLNDSISNASSPCQDLMLETPPISSNSSSSESEDEQEDDDDDEDCD
EEEEIDVVTVEKRQTASRRMESGSHSQSSRPHHSPLVLKRCHVPIHQHNYAASPSTKVDY
VSSKRAKLESNVRVLKQISNNRKYASPRSSDSEENDKRRTHNVLERQRRNELKLSFFALR
DQVPEVANNEKAPKVVILKKATEYAISMQEDERRLIRETEQLKYRKEQLKQRLQQLRNSV
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcctcttaacgccaattttcccagcaagaactacgactacgattatgacttgcagccc
tgcttcttctttctggaggaggagaacttctaccaccagcaaagccgactgcagccgccg
gcccccagtgaggacatctggaagaagtttgagctgctccccaccccgcccttgtcaccc
agccggagatccagccagtccagccttttcccctctacggctgatcagctggagatggtg
accgaattcctgggaggggacatggtcaaccagagctttatctgtgaggcggatgacgaa
gccttgctgaagtccatagtcatacaggactgtatgtggagtggcttctcggcggcggcc
aagctggagaaagtggtgtctgagaagctggcgtcataccaggcttctaggaaagagagt
gctctgtctacttctcagtgccagagtcaaccgccacagagccctcttaaatctccctcg
tgtgatgggagcttaaatctcggagggaccaacaggagcagccatgaattcctccaagac
cccagctcggattgggttgacccttcagtggtcttcccatacccactgaacgacagcatt
tccaacgccagctcaccttgccaagatctcatgttggaaacaccacccatcagcagcaac
agcagcagtagtgaatcagaagacgaacaggaagacgatgacgacgatgaagactgcgac
gaggaagaggagattgacgttgtcacggtagaaaaaaggcagacggcgtctaggcggatg
gaatccggttctcattcgcagtcctcccgaccccaccacagcccgttagttctgaagcgg
tgtcacgttcccattcaccaacacaactacgcggcatctccctcaaccaaagtggactat
gtttcttccaagagggcgaaactagaaagcaacgtccgggtcctcaaacagatcagcaat
aaccgcaagtacgccagccccaggtcctcggattccgaagagaacgacaagaggcggacg
cacaacgttttagagcgtcagaggcggaacgagcttaagttgagtttcttcgccttgcga
gaccaggtacccgaggtggcgaacaacgagaaggcccccaaagtcgtcatcctcaaaaag
gcaacggaatacgcaatttctatgcaggaggacgagcgacggctcatacgggaaacagaa
cagttaaagtacaggaaagagcagttaaaacagagactccaacagctaaggaactctgtc
taa

DBGET integrated database retrieval system