KEGG   Xenopus laevis (African clawed frog): 379264
Entry
379264            CDS       T01010                                 

Gene name
stat3.2.L, aprf, hies, stat3-A, stat3.2
Definition
(RefSeq) signal transducer and activator of transcription 3 (acute-phase response factor), gene 2 L homeolog
  KO
K04692  signal transducer and activator of transcription 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04217  Necroptosis
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    379264 (stat3.2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    379264 (stat3.2.L)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    379264 (stat3.2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    379264 (stat3.2.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    379264 (stat3.2.L)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 AP1AR Syntaxin-6_N
Other DBs
NCBI-GeneID: 379264
NCBI-ProteinID: NP_001079577
Xenbase: XB-GENE-1020979
UniProt: Q7ZXK3
LinkDB
Position
9_10L
AA seq 766 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAFAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSTYLEKPMEIARIVARCLWEEGRLLQTAV
AAAQQGGPASHPNAAVITEKQQMLEQHLQDVRKKVQDLEQKMKVVENLQDDFDFNYKTLK
SQSDLSELNGNNQSVTRQKMQQLEQMLTALDQLRRTIISDLASLLSAMEYVQKNLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIRKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELNY
QLKIKVCIDKDSGEGAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNLIDLVKKYMLALWNEGYIIGFISKERERALLSP
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHQEPTDPGTAPYLRTMFICVTPTTCTL
DLPMSPGTFDSVMQFPGEGSESGNGNQFETLTFDVDLPSECAASPM
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccaattgcagcagctggacaccagatacttggagcagttacaccag
ctctatagtgacagctttccaatggagcttcggcagttccttgccccgtggattgagagc
caagactgggcatttgcggccagtaaggagtctcatgccacattggtgtttcacaatctc
ctgggggagatagaccagcaatacagccgatttctgcaggaatccaatgtactttatcaa
cacaacctgcgacggattaaacagttcttgcaaagtacatatttggagaaacccatggag
attgctcgaatcgtagccaggtgcctgtgggaagaagggcgacttctccaaacggctgtg
gctgctgcacagcaaggtgggccggcgtcacaccccaatgcagccgtgatcactgaaaag
cagcagatgctggagcaacatttacaggacgtgcggaaaaaagttcaggaccttgagcag
aagatgaaagttgttgagaaccttcaggatgactttgatttcaactacaaaactttaaaa
agccaaagtgacctttctgagctgaatggcaacaatcagtcggtcacaaggcagaagatg
caacagttggagcagatgctgacggcattggatcagctgagaagaactattattagtgat
cttgcgagtctcctgtcagccatggaatatgttcagaagaatctgactgacgaagagctt
gctgattggaagagaaggcagcaaatagcctgcatcggtggacccccaaatatttgcctt
gatcgtcttgaaaactggataacttccctggcagagtcccagctacagacacggcagcag
atcagaaaactagaggagctacagcagaaagtttcctataagggggaccccattgttcag
caccgacccatgctggaggagagaattgtggaattatttcgaaatctcatgaaaagtgcg
tttgtagtggagaggcagccgtgcatgcccatgcatcctgaccgacccctcgttatcaag
actggagtacagtttactaacaaagtcaggctgctggtaaagttcccggagctgaattac
caactgaaaattaaagtttgcattgacaaggattcgggtgaaggtgctgcactaagaggt
tcccgcaagttcaacatacttggtacaaacaccaaagttatgaacatggaggaatcaaat
aacgggagcctgtctgctgagttcaaacacttgactctgagggagcagcgatgtggcaat
gggggaagagcaaactgtgatgcctcccttatagtgacagaagaactccatctaatcaca
tttgaaactgaagtttatcaccaggggctgaagattgacctggagactcattccctgcct
gttgtggtgatttctaatatctgtcagatgcccaatgcttgggcctctatcctgtggtac
aacatgctgaccaacaacccaaagaatgttaatttctttaccaagcccccgattggcact
tgggatcaggtggcagaggtgctgagctggcagttttcctccaccacaaaacgtggccta
agtattgagcaactaaccacactggcagagaaactgttgggtccgggagtcaactattcc
ggatgccaaatcacctgggccaagttctgtaaagaaaatatggctggcaaagggttttcc
ttctgggtttggctggacaacctcattgaccttgtgaagaaatatatgctggcactttgg
aatgaagggtatattatcggcttcatcagcaaagagcgtgagcgagctcttctgagtccc
aaacccccaggaaccttcctgctgaggttcagtgaaagcagcaaggagggaggcatcacc
ttcacctgggtagagaaggacatcagtggtaagactcagattcaatcagtggaaccctac
accaagcaacaactgaacagcatgtcatttgctgaaattattatgggatataaaatcatg
gacgctaccaatatcctggtgtcccctttggtttacctgtatcctgatattcctaaagag
gaagcctttggaaaatactgccgcccagagagccaggagcaccaggagcccacagaccca
ggcactgctccatatctgaggaccatgttcatctgcgttaccccgactacgtgcacactg
gatttgccaatgtctccagggacttttgattctgtgatgcagtttccaggggaagggtca
gaatccggcaatggaaaccagtttgagaccctcacatttgatgtggatctaccgtctgaa
tgtgcagcttctcccatgtga

DBGET integrated database retrieval system