KEGG   Xenopus laevis (African clawed frog): 379404
Entry
379404            CDS       T01010                                 

Gene name
ccng1.L
Definition
(RefSeq) cyclin G1 L homeolog
  KO
K10145  cyclin G1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    379404 (ccng1.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 379404
NCBI-ProteinID: NP_001079717
Xenbase: XB-GENE-17344893
UniProt: Q802B8
LinkDB
Position
3L
AA seq 295 aa
MIETLVTSNAQDLLCQLNSLLELEVKCQPKVCGLRLIESTHDNGLRMTAKLRDFEVKDLL
SLTQFFGFRTETFSLSVNLLDRFLSKMKVQAKHLGCVGLTCFYLAVKAIEEERNVPLATD
LLRISQYKFTVFDMMRMEKIVLEKLGWKVKATTAVHLLHLYHSLVFDNLTSERKKLLSLE
RLETHLKACHCRIGFSKAKPSMLALSILALEIQEQKLFELLDAMECLQNHSNISSRDLHC
WKELVGKCLSEYASSKCSKPNVQKLKWIVSGRTARQLKHSYYRIAHLPTIPESGS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgattgaaacacttgtaacatccaatgctcaagatcttctttgccagctgaactcactc
ttggagctggaagtgaaatgccagccaaaggtttgtggtttacgtctgattgaatctacc
catgacaatggcctccggatgaccgccaaactgcgtgactttgaagtgaaggatttgctt
agcttgactcaattcttcggttttaggactgagaccttctcgttatctgtgaatcttttg
gacaggttcttatccaaaatgaaggtacaagcaaaacatttaggctgtgttggacttacc
tgtttctaccttgctgtaaaagcaatagaagaagaaaggaatgttccgcttgcaacagac
ctgctaaggataagccaatataagttcactgtttttgacatgatgcgtatggaaaagatt
gttctggaaaagttgggttggaaagttaaagctacgacagccgtacacctcttgcatcta
tatcattcccttgtgtttgacaacttgacaagtgaaaggaaaaagctgctttctctagag
agacttgaaactcatctgaaagcttgccactgtaggattggcttttccaaagctaagccc
tccatgctggcgttgtcaatattggcactggagattcaagaacagaagctgtttgagcta
ttggatgcgatggaatgtctgcagaatcattccaatattagcagcagagacctgcactgt
tggaaggaactggtaggcaaatgcctttctgaatatgcctccagtaaatgttctaagcca
aacgttcaaaagctcaagtggattgtgtcaggacgcacagcaaggcaactgaagcacagt
tactacaggatagcacatcttccaacaattccagaatctggctcctaa

KEGG   Xenopus laevis (African clawed frog): 431934
Entry
431934            CDS       T01010                                 

Gene name
ccng2.S, ccng2
Definition
(RefSeq) cyclin G2 S homeolog
  KO
K10146  cyclin G2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    431934 (ccng2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    431934 (ccng2.S)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 431934
NCBI-ProteinID: NP_001084883
Xenbase: XB-GENE-6251557
UniProt: Q6NRC3
LinkDB
Position
1S
AA seq 349 aa
MKDLAAMDHTSNEALKLLKQLNLHLELESKYQPREKGLILIESTVENDNTICPRLRNAKV
EDLWSLTNFFDLTMETFVLAVNILDRFLAVMKVKPKHLSCIGVCSFQLAARVVEEDCNIP
SVHDVIRISQCKCTVSDMKRMEKIISDKLHFEFKATTALTFLHLYHTIVLCHSSERKEVL
NLDKLEAQLKACNCRLIFSKAKPSVLALCLLTLEVETLKSLELFEIALRVQKHSKVSDED
MLYWRELVSKCLADYSSPECCKPDHRKLVWTVSRRTAQNLHNSYYSVPELPTIPECGCIN
ESESEDSCEEMSSGEDSLSSSPPSDLEASFFFDNCKPRLKRLTRHLYPL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaggatttggcagctatggatcatacaagcaacgaggccttaaaactcttgaagcag
ctgaatttacacctagagctggagtccaaatatcagcccagggagaagggcttgatcctc
atcgagtccacagtagagaatgataacacaatctgtccgaggctgaggaatgcaaaagtg
gaagatttatggagtctgacaaacttttttgatctgactatggaaacgtttgtgttggct
gttaacattttggacagattcttggcagtcatgaaggtgaaaccaaagcatttgtcttgc
atcggagtctgcagctttcagttggcagccagagttgtggaggaagactgcaatattcca
tctgttcacgatgtgatccgtatcagccagtgtaaatgcactgtgtcagacatgaaacgc
atggaaaagatcatttcagacaaattgcactttgaattcaaagctacaactgccttaaca
tttttgcacttgtatcacacaatagtcctctgccattcctctgagaggaaagaagtatta
aacctggacaaactggaagctcagctgaaagcttgcaattgtcgtctcattttttcaaaa
gcaaaaccctcagtgttagccttgtgccttcttactcttgaagtagaaaccttaaagtct
ctagaactatttgaaattgctcttcgcgtacaaaagcattccaaggtcagtgatgaggat
atgctgtactggagagagctagtgtcaaaatgcctggcagattattcttctcctgagtgc
tgcaagccggatcataggaaactggtatggactgtgtcccgacgtacagctcaaaacctg
cacaatagctactacagtgttccagagttgccaaccattccagagtgtggctgtataaat
gaaagtgaaagtgaggattcgtgtgaagagatgagcagtggcgaagacagtctgagcagc
tctccaccaagtgacctagaagcatctttcttttttgataattgcaaaccaaggctaaaa
agactgactcgtcatctgtaccctttgtag

KEGG   Xenopus laevis (African clawed frog): 444607
Entry
444607            CDS       T01010                                 

Gene name
ccng2.L
Definition
(RefSeq) cyclin G2 L homeolog
  KO
K10146  cyclin G2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    444607 (ccng2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    444607 (ccng2.L)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 444607
NCBI-ProteinID: NP_001086178
Xenbase: XB-GENE-17343105
UniProt: Q6GM00
LinkDB
Position
1L
AA seq 356 aa
MKDLAAMDHTSNKAFKLLKQLNLQLEQESKYQPREKGLILIESTAENDSTICPRSRNAKV
EDLWSLTNFFGLSMETFVLAVNILDRFLAIMKVKPKHLSCIGVCCFQLAARVVEEDCNVP
SVHDVIRISQCKCTVSDMKRMEKIISEKLHFEFKATTALTFLHLYHTIVLCHSCERKEVL
NLDKLEAQLKACNCRLIFSKAKPSVLALCLLTLEVETLKSLELFEIALRVQKHSKVNDED
MLYWRELVSKCLADYSSPECCKPDHRKLVWTVSRRTAQNLHNSYYSVPELPTIPECGCIN
ESESEDSCEEMSSGEDSLSSSPPSDLEASFFFDNCKPRLKRLTHHMLCSKGQSVVL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaaggatttggcagctatggatcatacaagcaacaaggcttttaaactactgaagcaa
ctgaatttacaactagaacaggagtctaaatatcagcccagggagaagggcttgatcctc
atcgagtccacagcagagaatgatagcacaatctgtccgaggtcaagaaatgcaaaagtt
gaagatttatggagtctgactaacttttttggactgagtatggaaacatttgtgttggct
gttaacatcttggacagattcttggcaatcatgaaggtgaaaccaaagcatttgtcttgc
atcggagtctgctgctttcagctggcggccagagttgtggaggaagactgcaatgttcca
tctgtccacgatgtgatccgtatcagccaatgtaaatgcactgtgtcagacatgaaacgc
atggaaaagatcatttcagagaaattgcactttgaattcaaagctacaactgccttaacg
tttttgcacttgtatcacacaatagtcctctgccattcctgtgagaggaaagaagtatta
aacctggacaaactggaagctcagctgaaagcttgcaattgtcgcctcattttttcaaaa
gcaaaaccctcagtgttagccttgtgccttcttactcttgaagtggaaaccttaaagtct
ttagaactgtttgaaattgctcttcgtgtacaaaagcattccaaggtcaacgatgaggat
atgctgtactggagagagctagtctcaaaatgtctggcagattactcttctcctgagtgc
tgcaagccagatcatagaaaactggtatggaccgtgtcccgacgtactgctcaaaacctg
cacaatagttactacagtgtcccagagttgccaacaattccagagtgtggctgtataaat
gaaagtgaaagtgaggactcgtgtgaagagatgagcagtggtgaagacagtcttagcagc
tctcccccaagtgacctagaagcatctttcttttttgataattgcaaaccaaggctaaaa
agactgacacatcatatgctttgtagcaaaggacaatctgtagttttataa

KEGG   Xenopus laevis (African clawed frog): 779347
Entry
779347            CDS       T01010                                 

Gene name
ccng1.S, ccng1
Definition
(RefSeq) cyclin G1 S homeolog
  KO
K10145  cyclin G1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    779347 (ccng1.S)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 779347
NCBI-ProteinID: NP_001090435
Xenbase: XB-GENE-6077807
UniProt: A0JMV5
LinkDB
Position
3S
AA seq 295 aa
MIETLVTCNAQDLLCQLNSLLELEVKCQPKACGLRLIETAHDNGLRMTSKLRDFEVKDLL
SLTQFFGFSTETFSLTVNLLDRFLSKMKVQPKHLGCVGLTCFYLAVKAIEEERNVPLATD
LLRISQYKFTVFDMMRMEKIVLEKLGWKVKATTAVYLLKLYHSLVFDNLTSERKKLFSPE
RLETHLKACHCRIGFSKAKPSVLALSILALEIQEQKLFELMDVMECLQNHSNISSRDLHC
WKELVGKCLAEYASSKCSKPNVQKLKWIVSGRTARQLKHSYYKVAQLPTIPESGS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgattgaaacacttgtaacatgcaatgctcaagatcttctttgccagctgaactcactc
ttggagctggaagtgaaatgccagccaaaagcttgtggtttacgtttgattgaaactgcc
catgacaatggcctccgaatgacctccaagctgcgtgactttgaagtgaaagatttgctt
agcttaactcagttctttggttttagtactgagaccttctctttaactgtgaatcttttg
gacaggttcttatccaaaatgaaggtacaaccaaaacatttaggctgtgttggacttacc
tgtttctaccttgctgtaaaagcaatagaagaagaaaggaatgttcctcttgcaacagac
ctactcaggataagccagtataagtttactgtttttgacatgatgcgaatggaaaagatt
gttctggaaaagttgggttggaaagttaaagctacgacagccgtatacctcttgaaactt
tatcattcccttgtgtttgacaacctgacaagtgaaaggaaaaagctgttttctccagag
agacttgaaactcatctgaaagcttgccactgtaggattggattttccaaagctaagccc
tctgtactggcattatcaattttggcactggagattcaagaacagaagctgtttgaacta
atggatgtaatggagtgtctgcagaatcattccaatattagcagcagagacctgcactgt
tggaaggaactggtaggcaaatgccttgctgaatatgcctccagtaaatgttctaagcca
aatgttcaaaagctcaagtggattgtgtcaggacgcacagcaaggcaactgaagcacagt
tactacaaggtagcacaacttccaacaattccagaatctggctcctaa

DBGET integrated database retrieval system