KEGG   Xenopus laevis (African clawed frog): 379632Help
Entry
379632            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC68847
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00030  Pentose phosphate pathway
xla00051  Fructose and mannose metabolism
xla00052  Galactose metabolism
xla01100  Metabolic pathways
xla01200  Carbon metabolism
xla01230  Biosynthesis of amino acids
xla03018  RNA degradation
Module
xla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    379632
   00030 Pentose phosphate pathway
    379632
   00051 Fructose and mannose metabolism
    379632
   00052 Galactose metabolism
    379632
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    379632
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    379632
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xla03019]
    379632
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     379632
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     379632
Messenger RNA biogenesis [BR:xla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     379632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 379632
NCBI-ProteinID: NP_001079941
UniProt: Q6PF67
LinkDB All DBs
Position
6L
AA seq 784 aa AA seqDB search
MAQPDKKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMV
DGGDNIEEVSWESVSSILQVGGTVIGSARCKSFRNREGRLQAACNLVQRGITNLCVIGGD
GSLTGANLFREEWSGLLDELVQTGKIEAEAAKEYAHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIMEVVDAIMTTALSHQRTFVLEVMGRHCGYLALVSALACGADWMFIPESPPEEGW
EDLMCNKLSENRARKKRLNIIIVSEGAIDCHNKPITSDLVKDLVVKRLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVDCVLALLEATPETPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDERRFEDAVRLRGRSFENNLNTYKLLSHKKNISELPKSNFNVAVLNVGAPAAGMNAA
VRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGGVGGWTGQGGSLLGTKRTLPAKYF
DQIAEQIRTNKIHALLVIGGFEAFLGLLEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
SFDIRELQANVEHLTEKMKTSIQRGLILRNENSNENYTTDFIYQLYSEEGRGVFDCRKNV
LGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRNGRVFANTDDSVCLLGMRRRNL
LFQPVTQLKDETDFKHRIPREQWWLKMRPLMKILAKYKTSYDISDAGKLEHVNMCRRKDE
TGAI
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccagataagaagcttttcgagaatctgtccgggaagggcaaagccatcggg
gtactgacaagcggaggagatgcccaaggtatgaacgcagctgtgcgcgctgtagtgcga
atgggcatctacgtacaagccaaagtgtacttcatttatgagggataccaaggaatggtg
gacggaggagacaatattgaggaagtgtcgtgggaaagcgtttctagcatcttgcaagtg
ggtgggaccgtcatcggcagtgcacgttgcaagtcattccggaatcgcgaaggtcgtttg
caggcagcttgtaacctagttcagcggggaattaccaacctctgtgttatcggaggtgac
ggcagtctgacaggcgctaacctgttccgagaagaatggagcgggcttcttgacgaactc
gtgcaaactgggaaaattgaggcggaagcagctaaagagtatgcccatctgaacattgtg
gggatggtgggatctatagataatgatttctgtggaactgatatgaccattggaacagac
tcagccctgcataggattatggaagttgttgacgctatcatgaccaccgctctaagccac
cagaggaccttcgtgctggaagtcatgggaagacactgcgggtacctcgccttggtcagt
gccttagcttgtggggcagactggatgtttatccctgaatccccaccggaggagggatgg
gaagacttgatgtgcaacaaactgtctgagaatcgtgcaaggaagaaaaggcttaatatc
atcattgtatcagaaggggctattgactgccataataagccaatcacgtcagacttggtt
aaagatctggttgtaaaacgcctgggatttgatactcgtgttacaattttgggccatgtc
caaagaggtggaaccccatcagccttcgacagaattctggcaagtcgaatgggagtggat
tgtgtcttggccctgcttgaagctactccagaaacgccggcctgtgttgtgtcgttatgt
ggaaaccaagctgtgcgcctgccccttatggaatgcgttcagatgacccaggaagtgcag
aaggccatggatgaaagaagatttgaagatgctgtaaggttacgaggaaggagctttgaa
aataacctcaacacttacaagcttctctcccataagaaaaatatatcagagcttccaaag
agtaatttcaacgtggctgttttgaatgtgggggcacccgctgcgggcatgaacgccgca
gtcagatctgcagtgagagtgggaataacagagggacataaaatgtttgccgtcaatgat
ggttttgaaggatttgccaaggggcagattaaagagataaaatggggaggtgttggaggc
tggacaggccaaggtggatctcttttgggaacaaagaggacccttcctgctaaatacttt
gaccaaattgcagagcaaatccgaacgaataaaattcacgctcttcttgtcattggtgga
tttgaggccttcttgggactgctggaaatggttgagggccgagggaaatatgatgagttc
tgtatccctatggtcatggttcccgctactgtctccaacaatgtgcccggctcagatttc
agcattggtgcagatacagctctgaacactataaccgatacctgcgatcgcatcaaacag
tcagcgagtggaaccaaacggcgtgtgttcatcattgaaacgatgggtggctactgcggc
tacttggctaacatgggcggccttgcagctggtgcagacgcggcatacatcttcgaagaa
tcgtttgatattcgcgaactccaggcaaacgtggaacatttaacagagaaaatgaaaaca
agcatccaaagaggacttatactcaggaatgagaacagcaatgagaactacaccacagat
ttcatttatcagctttactcagaagaaggccgaggcgtgttcgactgcagaaagaatgta
ctggggcacatgcagcagggcggcgctccgtctccgtttgacagaaacttcggcaccaag
atttccgccaaagccgtccagtggatttccaagaagttaaaagaaacctacaggaacggc
agggtatttgcaaacacagacgatagcgtttgtctgttaggaatgcgcaggaggaacctc
cttttccagccagtgacacaactcaaggacgaaacagactttaagcacaggattcccagg
gaacagtggtggctgaagatgaggcctctgatgaagattctggccaagtacaagacgagc
tacgacatttcagacgcaggaaaactggaacacgttaacatgtgcagacggaaagatgaa
acgggagcaatttga

DBGET integrated database retrieval system