KEGG   Xenopus laevis (African clawed frog): 379785
Entry
379785            CDS       T01010                                 

Gene name
cdk1.L, MPF, PSTAIR, cdc-2, cdc2, cdc2-b, cdc28a, cdc2a, cdc2x1.1, cdc2x1.2, cdk1, cdk1-a, cdk1-b, p34cdc2, xcdc2
Definition
(RefSeq) cyclin-dependent kinase 1 L homeolog
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04540  Gap junction
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379785 (cdk1.L)
   04114 Oocyte meiosis
    379785 (cdk1.L)
   04115 p53 signaling pathway
    379785 (cdk1.L)
   04218 Cellular senescence
    379785 (cdk1.L)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    379785 (cdk1.L)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    379785 (cdk1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    379785 (cdk1.L)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    379785 (cdk1.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    379785 (cdk1.L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    379785 (cdk1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     379785 (cdk1.L)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     379785 (cdk1.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   379785 (cdk1.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    379785 (cdk1.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    379785 (cdk1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   379785 (cdk1.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Seadorna_VP7 Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 379785
NCBI-ProteinID: NP_001080093
Xenbase: XB-GENE-6254942
UniProt: P24033
LinkDB
Position
7L
AA seq 302 aa
MDEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSTAIREISLLKELQH
PNIVCLLDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRASEVLLGSVR
YSTPVDVWSVGTIFAEIATKKPLFHGDSEIDQLFRIFRSLGTPNNEVWPEVESLQDYKNT
FPKWKGGSLSSNVKNIDEDGLDLLSKMLVYDPAKRISARKAMLHPYFDDLDKSSLPANQI
RN
NT seq 909 nt   +upstreamnt  +downstreamnt
atggacgagtacactaaaatagagaagattggagagggcacatatggggtcgtgtacaag
ggtcgtcacaaagcaaccggccaggtcgtcgcaatgaagaaaattagattggaaaatgaa
gaggaaggtgtcccaagtacagcaatccgagaaatatcactacttaaagagcttcagcac
cccaacatagtctgcctcctagatgtcctcatgcaagactcaaggttgtatcttatcttt
gagtttctctccatggatctaaagaagtatttagactcgatacccagcggccagtatatc
gatacaatgctcgttaagagttacctgtaccagatcctacaagggattgtattctgtcac
tccagacgagttctacacagagacctgaaacctcaaaacctgctcatagacaataaagga
gtgataaagttggcagattttggccttgccagagcttttggaattccggttcgggtttac
acacacgaggtcgtgacgttatggtacagagcctcggaagtgctgttggggtcagtccga
tattcaacgccagttgacgtctggagcgtaggaactattttcgccgagatcgccacaaag
aaacccctcttccacggtgactctgaaattgaccagctcttcaggatattcagatcttta
gggacacccaacaatgaagtgtggccagaagtagagtctttacaagattacaagaacaca
ttccccaaatggaaagggggaagcctgtcgtcgaatgtgaaaaatattgatgaggatggg
ctggacctgctgtctaaaatgctagtctatgatcccgccaagaggatttccgcacgaaaa
gctatgttgcacccctacttcgatgacttggataagtccagccttcccgccaatcagatt
agaaattaa

KEGG   Xenopus laevis (African clawed frog): 380246
Entry
380246            CDS       T01010                                 

Gene name
cdk1.S, MPF, PSTAIR, cdc-2, cdc2, cdc2-a, cdc28a, cdc2x1.1, cdk1-a, cdk1-b, p34cdc2, xcdc2
Definition
(RefSeq) cyclin-dependent kinase 1 S homeolog
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04540  Gap junction
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    380246 (cdk1.S)
   04114 Oocyte meiosis
    380246 (cdk1.S)
   04115 p53 signaling pathway
    380246 (cdk1.S)
   04218 Cellular senescence
    380246 (cdk1.S)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    380246 (cdk1.S)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    380246 (cdk1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    380246 (cdk1.S)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    380246 (cdk1.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    380246 (cdk1.S)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    380246 (cdk1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     380246 (cdk1.S)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     380246 (cdk1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   380246 (cdk1.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    380246 (cdk1.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    380246 (cdk1.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   380246 (cdk1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Seadorna_VP7 Haspin_kinase Choline_kinase
Other DBs
NCBI-GeneID: 380246
NCBI-ProteinID: NP_001080554
Xenbase: XB-GENE-482754
UniProt: P35567 A0A1L8FE96
LinkDB
Position
7S
AA seq 302 aa
MDEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSTAIREISLLKELQH
PNIVCLLDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDSKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSVR
YSTPVDVWSIGTIFAEIATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNS
FPKWKGGSLSANVKNIDKDGLDLLAKMLIYDPAKRISARKALLHPYFDDLDKSSLPDNQI
RN
NT seq 909 nt   +upstreamnt  +downstreamnt
atggacgagtacactaaaatagaaaagatcggagagggcacatatggggttgtgtacaaa
ggtcgtcacaaagcaactggccaggttgttgcaatgaagaaaattcgattggaaaacgaa
gaggaaggtgtcccaagtacagcaatccgagaaatatcactacttaaagagcttcagcac
cctaacatagtttgtctcctagatgtcctcatgcaagattcaaggttgtatcttatcttt
gagtttctctccatggatctaaagaagtatttggactccatacccagcggccagtatata
gatacgatgctcgttaagagttacctataccagatcctacaaggcattgtattttgccac
tccagaagagtgctacacagagacctgaaacctcagaacctgctcatcgacagcaaggga
gtgataaagttggcagattttgggcttgccagagctttcggcattccagttcgggtttac
acacatgaggtagtgacattatggtacagagccccagaagtgctgttggggtcagtccga
tattccacgccggttgatgtttggagcataggaaccatttttgctgagattgccacaaag
aaacccctcttccacggtgactctgaaattgaccagctcttcaggatattcagagctttg
ggaacacccaacaatgaggtgtggccagaagtagaatctttacaagattacaagaactca
ttccccaaatggaaaggggggagcttgtcggcgaacgtgaaaaatatcgataaggatggg
ctggacctactggctaaaatgctaatctatgatccagccaagagaatttccgcacgtaaa
gctttgctgcacccctacttcgatgatttggataagtccagccttcctgacaatcagatt
agaaactaa

DBGET integrated database retrieval system