KEGG   Xenopus laevis (African clawed frog): 380178Help
Entry
380178            CDS       T01010                                 

Gene name
hdac6.L, hd6, hdac6, jm21
Definition
(RefSeq) histone deacetylase 6 L homeolog
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    380178 (hdac6.L)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xla03019]
    380178 (hdac6.L)
   04131 Membrane trafficking [BR:xla04131]
    380178 (hdac6.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    380178 (hdac6.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     380178 (hdac6.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     380178 (hdac6.L)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     380178 (hdac6.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    380178 (hdac6.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     380178 (hdac6.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 380178
NCBI-ProteinID: NP_001080486
Xenbase: XB-GENE-5874020
UniProt: Q7ZYF0
LinkDB All DBs
Position
8L
AA seq 1286 aa AA seqDB search
MASPQDPTAVPPRGLTGASRSPVTPACSMGKPRKKGASPQGPQSLQEVKKRGHRMKRSPD
QQLCDQLEGLNLLAEAAVQGTGLVYDEQMAHNYCLWDENFPECPGRIWAVRDKMAEYGLA
ERCVAVPAREASEEEILLIHSPQYVALMRSTQKMTMDELRALSDRYDSVYLHPTSFTCAS
LAVGSVLQLVDRVQHGEIRNGLAVVRPPGHHAHTDQMNGYCMFNQLAIAARYAQLTYGAK
RVLIVDWDVHHGQGTQFIFESDPSVLYFSVHRYDNGGFWPHLKESASSAVGKERGERFNV
NVAWNKTRMSDADYIHVFLNVLLPVAYEFQPHLVLVAAGFDSVVGDPKGEMSATPACFSH
LTHLLMSLAQGRLILSLEGGYNQRSLAEGACASLKALLGDPCPRLTLPSAPCQSALDSMS
DTISAHCSLWKMLQDYESEGEPIIEPQSAKDGPPEGTDEPPLEKFLEQAMIEVMRKVPEQ
RTALVYDEQMMEHRNMWDCYHPESPQRINQIFKRHKDLGLLERCSRLPSRLATQKELQMC
HSLSYIQKIEASAHMKPRDLHRLGDEYNSIYINSKSYHSARLAAGSTFNVVEAVVTGKAQ
NGIGIVRPPGHHAEPGEACGFCFFNTVALAARYAQRLQSQSEDPLRVMILDWDVHHGNGT
QHIFQEDASVLYMSLHRYDEGLFFPNSEDASHDKVGIGKGAGYNVNIPWNGGKMGDVEYL
MAFHRVVMPIAYEFNPQLVLISAGFDAARGDPLGGCQVSPEGYAHMTHLLMSLAGGRVIL
VLEGGYNLTSISESMVMCTRSLLGDPPPVLSDLRPPKSSALNSVCKVRQAHRKYWRSLRL
NVVGPPPKSTQGAKNLQHSPMRNSPRKGRFAAEAGPLTESKISSQGASSPKKIPSEVTVT
PLASPLSSVSIEETPIPLIPDSKFSPEEVANQFVSAETAVQFAAPQYKMSTEEVANKLAS
PQGLTSLESTSSQLVSNREAIAPAWEHETPKSPPTADSQKVPMGGLVAAEDIADALAERG
LTMEILGCSEQRENVCKCKASPQSLQHEDKLLDVQSPGVRIASGKESEAPVPPCSTVEER
PLEQILRDLQLSDDASSSSSIAMAHTADLDPRDRAIRKSFITTGRDTPEEEYTEGSYIQV
ANAPPNEQELLDEAAGGSEAGNSTIGFEVFLNSMEDESDVGFAVMPLSWCPHLGSVCAVP
RDGVDVSQPCAQCGSELENWLCLTCYQVLCGRYVSQHMLSHGLTSGHHLVLSFSDLSVWC
YGCESYVHNEALFPAKSAAYSSKFEE
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccacaggatcctacagcagtgcccccccgggggctgaccggtgcctcccgc
tctcctgtgacccccgcatgcagcatggggaagcccaggaagaaaggtgcatccccccaa
ggcccccagtccctgcaggaagtaaagaagaggggccacaggatgaagcgcagccctgac
cagcagctgtgtgaccaactcgaggggctgaatttgttggcagaggcagccgtgcaagga
acgggactggtttatgatgagcagatggcacacaactactgtttatgggatgaaaacttt
cctgaatgcccaggccgtatctgggctgtgagagacaagatggctgaatacggcctggca
gagcgatgtgtggcggtgccggctcgtgaagcatcagaggaggaaatcttgctcattcac
agcccccagtatgtggcactgatgagatccactcagaaaatgaccatggatgagcttaga
gctctgtctgaccgctatgattcggtgtacttgcacccgacgtctttcacttgcgcctct
ttggccgtgggctcagtgctccagctggtggatagagttcagcatggggagatccgcaat
ggattggctgttgtcaggcctcctggacatcacgcacacactgaccagatgaacggttac
tgcatgtttaaccagcttgctattgctgcccgatacgcccaactgacatatggtgccaaa
cgggtcctaattgtagactgggacgtgcatcacggtcagggcacacagttcatatttgag
agtgatcccagtgtcctgtacttttctgtccatcgctatgacaacgggggtttttggccc
catctaaaagaatcggccagttcagctgtggggaaggaacgaggagagcgattcaatgtg
aatgtggcctggaacaagaccagaatgagtgatgctgattatatccacgtgttccttaat
gtcctacttcctgtcgcctacgagttccagcctcaccttgtgttggtagcagctgggttt
gactctgtggttggagaccctaagggagagatgtcggccaccccagcgtgtttctctcac
ctcactcacctgctgatgtcactggcacagggcagactcattctttcactagagggtggg
tacaatcagcgctcattggcagaaggagcctgtgcatctctgaaagccttactgggtgac
ccgtgcccaagactgaccctgccatctgcaccctgtcaaagtgccctggattcaatgtct
gacacaataagtgcccattgcagcttatggaagatgctgcaggattacgagagtgaagga
gagcccattattgaaccccagagtgctaaagatggcccccctgaggggacagatgagcct
cctctggagaaatttctagaacaggcaatgatcgaagtgatgcggaaagtgccagagcag
cgaacagcgctggtgtatgatgagcaaatgatggagcatcgcaatatgtgggactgttat
cacccagagtctccacagaggataaaccagatatttaagcggcacaaggatctggggctg
ttagaacgttgcagtcgccttccatcacgcttggccactcagaaggagctacagatgtgc
cacagtctctcctacatccagaagattgaggcatctgctcacatgaaaccacgagacctg
cacaggctgggggatgagtacaactccatttatatcaattccaaatcctaccacagtgcc
cggctggcagctggctctaccttcaatgtagtggaggccgtggttacaggaaaggcacaa
aatggaattggcattgttcgccctccgggtcatcatgcagaaccaggggaagcctgtggt
ttctgtttctttaacaccgtggcactagctgcccgctatgcacagagactgcagagccaa
tcagaggatccactcagagtaatgattttggattgggatgtacaccatggcaatggcacg
cagcacatcttccaggaggatgccagtgtgctctacatgtccctccaccgatacgatgag
ggtctcttctttccaaattcagaagatgcatcacatgacaaggttggcattgggaagggg
gcaggatacaatgtgaacatcccttggaatggcggaaagatgggggatgtggaatattta
atggcgtttcacagagtggtgatgcccattgcttatgagtttaaccctcagctagttctc
atatcggctgggtttgacgcggcccgtggggatccacttgggggctgccaggtgagccct
gaaggttatgcccatatgacacaccttctgatgagcctggcaggtggcagagtcatcctg
gtgctagagggtgggtacaatctcacatccatctccgagtccatggttatgtgcacccga
tcgctcttgggggaccccccaccagttctgtctgacctgcgacctccaaaatcatcagct
ttgaactccgtttgcaaagtccgtcaggcacatcgcaaatactggcgcagccttcggcta
aatgtggtaggacctccccccaagtctactcagggagcaaaaaatctccagcattcccca
atgaggaactctccccgtaaaggaagatttgctgcagaggctggacccttaacagagagc
aagatctcttctcaaggagcttcatctccaaaaaaaatcccctcagaagtgacagtcacc
cccctggcatcaccactgagctcagtctccatagaagagacacctatcccattgatacca
gacagcaaattctccccagaagaggtagccaaccaatttgtatctgcagagactgctgtt
cagttcgctgcaccacagtacaagatgtccacagaggaggtagccaataagctggcatca
cctcaaggactgacatcacttgaaagtacaagcagtcagctggtatccaacagggaagcg
attgcgccagcatgggaacatgaaacccccaaatctcctcccaccgcagacagccagaaa
gtacctatgggaggattagtagcagcagaagacattgcagatgccctagcagagaggggc
cttacaatggagatattggggtgctctgagcagcgagagaatgtgtgtaaatgtaaagca
tctccacaatccttgcagcatgaggacaagttattagacgttcagtctccaggggtgaga
attgcatccgggaaagagagtgaggcaccagtgcccccctgttccactgttgaggaaaga
cctttagaacaaattctcagagacttgcagttgagtgatgatgcgtccagcagttcctcc
attgccatggctcatacagctgacttggatcctagggacagagccataaggaaatccttt
atcactacaggaagagacactccggaggaagagtatacagagggcagttatatacaggtg
gctaatgcaccacccaatgagcaggagctgctggacgaggctgcggggggctcggaagct
ggaaactccaccataggctttgaggtttttctgaactctatggaggatgagtcggatgtg
ggatttgcagtcatgccgctgtcctggtgtcctcacttgggctctgtgtgtgctgtgccc
cgggatggtgtggatgtgagccagccgtgtgcccagtgtggcagtgaactggagaactgg
ctctgtctgacttgttaccaggtgctgtgtggcaggtatgtctcccaacacatgctgagc
catggactcacctctggacatcaccttgttctcagcttctctgacttgtctgtgtggtgc
tacggctgtgagtcctatgtacataacgaggccttgtttccagccaaatctgctgcctac
agctccaagtttgaggagtag

DBGET integrated database retrieval system