KEGG   Xenopus laevis (African clawed frog): 380219
Entry
380219            CDS       T01010                                 

Gene name
ccne2.L, ccne2
Definition
(RefSeq) cyclin E2 L homeolog
  KO
K06626  G1/S-specific cyclin-E1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    380219 (ccne2.L)
   04114 Oocyte meiosis
    380219 (ccne2.L)
   04115 p53 signaling pathway
    380219 (ccne2.L)
   04218 Cellular senescence
    380219 (ccne2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    380219 (ccne2.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    380219 (ccne2.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    380219 (ccne2.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    380219 (ccne2.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 380219
NCBI-ProteinID: NP_001080527
Xenbase: XB-GENE-923055
UniProt: Q7ZYC0
LinkDB
Position
6L
AA seq 397 aa
MSRRSGRLQARHGSAETGNDCQLAVATKKRKSEETSTTFECHQDAKRHNYEIQGCWSEIT
TGTVTPCILIETPHKEMPVSTDLSQFSRYRFKNLFISRSPLPELSWGNSKDVWMKMISKE
SRYVHSSRLLQNHPTLNPDMRSILLDWLIEVSEVYTLHRETFYLAQDFFDRFMLTQTCVN
KSMLQLIGVTALFIASKLEEIYPPKLYEFAYVTDGACTEDDILQMELIILKALKWELCPV
TAISWLNLYLQVSSLKDHPKLLLPQYSQEQFIHVAQLLDMCILHHTSLEFQYRILAAAAL
YHCTSIEVVTKATGLDMDSISECVHWMTPFASVVKKSFPLKLKVFKRISPEDMHNIQTHT
NYIDMLDDVKIPDRVLGESPVFIGGILTPPKSTEKTF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcaagaagaagtggccgtctacaagcaaggcatggaagcgctgagactgggaacgac
tgccaacttgcagttgcaacaaagaaacgcaaatctgaggaaactagcacaacatttgaa
tgccaccaggacgcaaaacgacacaactatgaaatccagggctgctggtcagagatcact
acaggaacagtgactccttgtattctcatagaaacgccacacaaagaaatgccagtctcc
accgacctatcacagttctcccgatacaggttcaagaatctcttcatcagccgatcccct
ctgccagagctaagctggggcaattcaaaggatgtgtggatgaagatgataagcaaagag
tcgagatatgtgcattctagccgtcttctacaaaatcatcccacgttgaacccagacatg
aggtctattctgctggactggctcatagaggtatccgaggtctacacgctacacagagaa
accttttacctagcccaggatttctttgatagatttatgctgacccaaacctgtgtgaac
aaaagtatgcttcagcttataggagttacggcactatttattgcttctaaattagaggag
atctacccgccaaaactttatgaatttgcatacgtcaccgatggtgcctgcactgaagat
gatattcttcaaatggagctcataatattaaaggctttgaagtgggaattgtgtcctgta
actgccatttcatggctgaacctgtacctgcaagtgtcttctcttaaagatcatccaaaa
ctgctgttacctcagtattctcaggagcagtttattcatgttgctcagcttctagacatg
tgtattctacaccatacctcgcttgaattccagtacaggatcttggcggctgctgcttta
taccactgtacctccatagaagttgttaccaaagctactggtctcgacatggacagcatc
agtgaatgtgttcattggatgactccttttgcgagtgttgtgaagaaaagtttcccatta
aagctgaaagtgtttaagaggatatcaccagaagatatgcacaatatccagacccacacc
aactacattgatatgctggatgatgtaaagattccagatcgtgttttgggtgagtctcct
gtgttcattggtggtatcctcacccctcccaagagtacggaaaagactttctaa

KEGG   Xenopus laevis (African clawed frog): 397840
Entry
397840            CDS       T01010                                 

Gene name
ccne1.L, ccne, cycE1, cyce2, cyclinE
Definition
(RefSeq) cyclin E1 L homeolog
  KO
K06626  G1/S-specific cyclin-E1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397840 (ccne1.L)
   04114 Oocyte meiosis
    397840 (ccne1.L)
   04115 p53 signaling pathway
    397840 (ccne1.L)
   04218 Cellular senescence
    397840 (ccne1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    397840 (ccne1.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    397840 (ccne1.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    397840 (ccne1.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    397840 (ccne1.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 397840
NCBI-ProteinID: NP_001081445
Xenbase: XB-GENE-17330407
UniProt: P50756 A0A1L8GL65
LinkDB
Position
4L
AA seq 408 aa
MPVISNPAVEKSTKDEGTASCSVRSRKRKADVAIFLQDPDETLDSLEMTKKKQYQDRGPW
SNEMTCKSPHKLIPTPEKEEHEPNPTNYSHFASLRFSPVSVSPLPRLGWANQDDVWRNML
NKDRIYLRDKNFFQKHPQLQPNMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRFMATQK
NVIKSRLQLIGITSLFIAAKLEEIYPPKLHQFSFITDGACTEDEITRMELIIMKDLGWCL
SPMTIVSWFNVFLQVAYIRELQQFLRPQFPQEIYIQIVQLLDLCVLDICCLEYPYGVLAA
SAMYHFSCPELVEKVSGFKVTELQGCIKWLVPFAMAIKEGGKSKLNFFKGVDIEDAHNIQ
THSGCLELMEKVYINQALLEEQNRTSPIPTGVLTPPQSNKKQKSDRAD
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgccagtgataagcaatcctgcagttgagaaaagcacaaaggatgaggggacagcaagc
tgtagtgtgcgctccagaaagagaaaggcagatgtggctattttcttgcaagacccagac
gagaccttggatagcttggaaatgaccaagaaaaaacaatatcaggacaggggaccatgg
agcaatgaaatgacatgcaaaagcccccacaaattgattcctacaccagaaaaagaggaa
cacgagccaaaccctaccaactactcacactttgcttctctccggttcagcccagtcagc
gtttctcctcttccacgtcttgggtgggctaatcaggatgatgtctggaggaacatgtta
aacaaagaccgaatttacctgagagacaagaatttctttcagaaacatccccagctgcaa
cctaatatgagggcaatcctcctagattggctaatggaggtttgtgaagtatacaaactt
cacagagaaacattttatctagcacaagatttctttgatcggtttatggcgactcaaaaa
aatgtgattaaaagtcgactgcagcttattggaatcacatctttgttcattgctgctaag
ctggaggaaatataccctccaaagctgcatcagttctcatttatcacagacggtgcctgt
acagaagacgaaattacaaggatggagttgatcataatgaaggatcttggttggtgctta
agtccgatgactatagtttcttggtttaatgtcttcttgcaagttgcgtatataagggaa
ctgcagcagttcctgcgcccacagttccctcaggaaatttatatacagatcgtgcagctg
ctggatttgtgtgtgcttgatatttgttgcctggagtatccatatggagttctcgcagct
tctgccatgtatcatttttcttgtcctgagctagtggaaaaagtttcagggtttaaggtg
acagagttacaagggtgcataaagtggcttgttccttttgcaatggccataaaagaaggt
ggaaaatcaaagttaaatttttttaaaggtgttgatatagaagatgcacacaatatacag
acacatagtggttgtttggaactgatggaaaaggtttacatcaaccaggctctgttagag
gagcagaataggacctcacctatacctactggtgttctgactcctccccagagtaacaag
aaacagaaatctgatcgagcagactaa

KEGG   Xenopus laevis (African clawed frog): 397841
Entry
397841            CDS       T01010                                 

Gene name
ccne1.S, ccne, ccne1, cycE3, cyclinE
Definition
(RefSeq) cyclin E1 S homeolog
  KO
K06626  G1/S-specific cyclin-E1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397841 (ccne1.S)
   04114 Oocyte meiosis
    397841 (ccne1.S)
   04115 p53 signaling pathway
    397841 (ccne1.S)
   04218 Cellular senescence
    397841 (ccne1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    397841 (ccne1.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    397841 (ccne1.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    397841 (ccne1.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    397841 (ccne1.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 397841
NCBI-ProteinID: NP_001081446
Xenbase: XB-GENE-972047
UniProt: O42575
LinkDB
Position
4S
AA seq 408 aa
MPVIRNPAAEKSTKDERTASCTVRSRKRKADVAIFLQDPDDTLDCLEMTKKKQYQDRGQL
SNEMTCKSPHKLIPTPEKEEHEPNPTSYPHFASLRFSPVSASPLPRLGWANQDDVWRNML
NKDRIYLRDKNFFEKHPQLQPNMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRFMATQK
NVIKSRLQLIGITSLFIAAKMEEIYPPKLHQFAFITDCACTEDEITSMELIIMKDLDWCL
SPMTMVSWFNVFLQVAYIRELQHFLRPQFPQEVYIQIVQLLDLCVLDICCLDYPYGVLAA
SALYHFSCPELMEKVSGFKLTELQGCIKWLVPFAMAIKDGGKSKLKFFKGVDIEDVHNIQ
THTGCLELMEKVHINRAVLEEQNRASPIPSGVLTPPQSDKKQKSDPAD
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcctgtgataagaaatccggcagctgagaaaagcacaaaggatgagaggacggcaagc
tgtactgtgcgctcccgaaagagaaaggcagatgtggctattttcttgcaagacccagat
gacactttggattgcttggaaatgacaaagaaaaaacaatatcaagataggggacaattg
agcaatgaaatgacatgcaaaagcccacacaaattgattcctacacctgaaaaagaggaa
catgagccaaaccctacaagctacccgcactttgcttcgctccggttcagtccagtcagc
gcttctcctcttccacgtcttgggtgggctaatcaagatgatgtctggaggaatatgtta
aacaaagaccgaatttacctgagggacaagaatttctttgagaaacacccccagttgcaa
cctaatatgagggcaatccttctagattggctaatggaggtttgtgaagtgtacaaactt
catagagaaacattttacctagcacaagatttctttgatcggtttatggcaactcaaaaa
aatgtaatcaaaagtcgactgcagcttattggaatcacatctttgttcattgctgctaag
atggaggaaatataccctccaaagctgcatcagtttgcatttatcacagattgtgcctgc
acagaagatgagattacaagtatggagctgatcataatgaaggatcttgattggtgctta
agtccaatgactatggtttcttggtttaatgtcttcttgcaagttgcatatataagagaa
ctgcagcactttctgcgcccccagttccctcaggaagtttatatacagatagtgcagctg
ctggatttgtgtgtgcttgatatttgttgcctggattatccatatggggttcttgcagct
tctgccttgtatcatttttcttgtcctgaactaatggaaaaagtttcagggtttaagctg
acagagttacaagggtgcataaagtggcttgttcctttcgcaatggccattaaggatggt
gggaaatcaaagttaaaattttttaaaggtgttgatattgaagatgttcacaatatacag
acacacactggttgtttggaactgatggaaaaggttcatatcaaccgggctgtattagag
gagcagaacagggcatcgccaataccaagtggtgttctgactcctccccagagtgataaa
aaacagaaatctgatccagcagactaa

KEGG   Xenopus laevis (African clawed frog): 495419
Entry
495419            CDS       T01010                                 

Gene name
ccne2.S
Definition
(RefSeq) cyclin E2 S homeolog
  KO
K06626  G1/S-specific cyclin-E1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    495419 (ccne2.S)
   04114 Oocyte meiosis
    495419 (ccne2.S)
   04115 p53 signaling pathway
    495419 (ccne2.S)
   04218 Cellular senescence
    495419 (ccne2.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    495419 (ccne2.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    495419 (ccne2.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    495419 (ccne2.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    495419 (ccne2.S)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 495419
NCBI-ProteinID: NP_001088545
Xenbase: XB-GENE-17335284
UniProt: Q5U4W4
LinkDB
Position
6S
AA seq 397 aa
MSRRSGRLQARHGSSDTGNDYQLEVATKKRKSEETSTTFECHQDAKRHNFEIQGCWSEIT
TGTVTPCILIETPHKEMPVSTDLSQFSRYRFKNLFISRSPLPELSWGNSKDVWMKMISKE
SRYVHSSRLLQNHPMLNPDMRSVLLDWLLEVSEVYTLHRETFYLAQDFFDRFMLTQTRVD
KSMLQLIGVTALFIASKLEEIYPPKLHEFAYITDGACSEDDILQMELIILKALKWELCPV
TAISWLNLYLQVSSLKDHPKLLLPQYSQEQFIHVAQLLDLCILHHTSLNFQYRILAAAAL
YHCTSIEVVTKATGLEMDNISECVHWMAPFVRVVKRSLPLKLKVFKKVAPEDMHNIQTHT
NFLDMLYDVKIPDGDLGESPVSIGGILTPPKSTEKTF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcaagaagaagtggccgtctgcaagcaaggcatggaagctctgacactgggaatgac
taccaacttgaagttgcaacaaagaagcgcaaatctgaggaaaccagcacaacatttgaa
tgccaccaggatgcgaaacgacacaactttgagatccagggctgctggtcagagatcact
acaggaacagtgaccccttgcattctcatagaaacgccacacaaagaaatgccagtctcc
accgacctatcgcaattctcaagatacaggttcaagaatctgttcatcagccgatcccct
ttgccagaactaagctggggtaattcaaaggatgtgtggatgaagatgataagcaaagag
tcaagatatgtgcactctagtcgtctactacaaaaccatcccatgctgaatccggacatg
aggtctgttctgctggattggctcctagaggtatcagaggtttacacactacacagagaa
accttttacctggcccaggatttctttgatagatttatgctgacccagacacgtgtggac
aaaagtatgcttcagcttataggagttacagcactctttattgcttctaaactggaggaa
atctatccaccaaaacttcatgagtttgcctacatcactgatggtgcctgcagtgaagat
gatattcttcaaatggagctcatcatactaaaggctttgaagtgggaactgtgtcctgta
actgccatttcatggctgaacctgtaccttcaagtgtcgtctctcaaagatcacccaaaa
ttgctgttacctcaatattctcaggagcagtttattcatgttgctcagcttctagacttg
tgtattctacaccatacctcgctaaacttccagtacaggatcttggcggctgctgcttta
taccactgtacttccatagaagtagttaccaaagctacaggtctcgaaatggacaacatc
agtgaatgcgttcattggatggctccttttgtgagagttgtgaagagaagcctcccatta
aagctgaaagtatttaagaaggtagccccagaagatatgcacaatatccagacccacaca
aacttccttgatatgctgtatgatgtgaagattccagatggtgatttgggcgagtctcct
gtgtccatcggtggcatcctcacccctcccaagagtacggaaaagactttctaa

DBGET integrated database retrieval system